BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_O13 (651 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 2.9 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 8.8 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 2.9 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 4/38 (10%) Frame = +3 Query: 150 ALVSGNV----TPNRPRLLKRPLTPTKHQPSPNVTPKS 251 AL+S N+ +P R + + +P+ Q SP+VT S Sbjct: 673 ALMSNNILPPESPTRDKSKQNEKSPSPQQRSPSVTDLS 710 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 337 NILFGDFFTIAXXFCNVGD 281 NILFG FT+ + D Sbjct: 158 NILFGHIFTVCRTLIYIDD 176 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,151 Number of Sequences: 336 Number of extensions: 2685 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -