BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_O12 (653 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ888865-1|CAI61930.1| 108|Tribolium castaneum modulator of act... 46 4e-07 AJ622939-1|CAF22091.1| 108|Tribolium castaneum ETS activity mod... 46 4e-07 >AJ888865-1|CAI61930.1| 108|Tribolium castaneum modulator of activity of ets genes protein. Length = 108 Score = 45.6 bits (103), Expect = 4e-07 Identities = 26/75 (34%), Positives = 37/75 (49%) Frame = +1 Query: 427 LPPEPXLWTXEDVSVFLKWCERXFDLPNFDMDLFQMNGKALCLLTKTXLGERCPAAXDVL 606 LP +P WT E V+ ++ + LP F MNGKALCL++ R P +L Sbjct: 32 LPKDPRQWTREHVAQWINLVTQQHGLPEVPSSRFLMNGKALCLMSLGMFLSRVPLGGKLL 91 Query: 607 HNVLQMLVRDAALLG 651 + Q+ + AAL G Sbjct: 92 YKDFQLRL-CAALYG 105 >AJ622939-1|CAF22091.1| 108|Tribolium castaneum ETS activity modulator protein. Length = 108 Score = 45.6 bits (103), Expect = 4e-07 Identities = 26/75 (34%), Positives = 37/75 (49%) Frame = +1 Query: 427 LPPEPXLWTXEDVSVFLKWCERXFDLPNFDMDLFQMNGKALCLLTKTXLGERCPAAXDVL 606 LP +P WT E V+ ++ + LP F MNGKALCL++ R P +L Sbjct: 32 LPKDPRQWTREHVAQWINLVTQQHGLPEVPSSRFLMNGKALCLMSLGMFLSRVPLGGKLL 91 Query: 607 HNVLQMLVRDAALLG 651 + Q+ + AAL G Sbjct: 92 YKDFQLRL-CAALYG 105 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,860 Number of Sequences: 336 Number of extensions: 2674 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -