Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P01_F_O07
         (653 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB264335-1|BAF44090.1|   87|Apis mellifera ecdysone-induced prot...    22   4.5  
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    22   4.5  
AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic ac...    21   7.9  

>AB264335-1|BAF44090.1|   87|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 87

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -3

Query: 345 LNKNRCLYCHV 313
           +N+NRC YC +
Sbjct: 66  INRNRCQYCRL 76


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -3

Query: 345 LNKNRCLYCHV 313
           +N+NRC YC +
Sbjct: 115 INRNRCQYCRL 125


>AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha-3 protein.
          Length = 537

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 9/30 (30%), Positives = 18/30 (60%)
 Frame = +1

Query: 316 MTVQTAVLIETLIELGAEVQWSSSNIYSTQ 405
           +TVQ  + +  LIE+  + Q  ++N++  Q
Sbjct: 59  LTVQLGLKLSQLIEMNLKNQVMTTNVWVEQ 88


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 182,456
Number of Sequences: 438
Number of extensions: 3920
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19804986
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)