BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_O04 (654 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 26 0.90 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 8.4 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 26.2 bits (55), Expect = 0.90 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 428 SEMLTKDEFKQLT-GNINEVLQIHEQFLGLL 517 +EM+ E + LT NI EVL IH Q L L Sbjct: 341 AEMVKPKELRDLTDANITEVLDIHLQRLSAL 371 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.0 bits (47), Expect = 8.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 554 VRGLFLQWAPKIKTVHQTYCGGHP 625 ++ L LQ P+ K + + Y GG+P Sbjct: 692 IKALRLQPVPEDKQIPEFYIGGNP 715 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 667,399 Number of Sequences: 2352 Number of extensions: 12258 Number of successful extensions: 37 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -