BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_N22 (461 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30230| Best HMM Match : CH (HMM E-Value=0.0035) 29 2.5 SB_36932| Best HMM Match : HTH_8 (HMM E-Value=1.4) 28 3.3 SB_49607| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) 27 7.6 SB_18070| Best HMM Match : V-ATPase_G (HMM E-Value=4) 27 10.0 SB_15093| Best HMM Match : Rho_N (HMM E-Value=8.1e-05) 27 10.0 >SB_30230| Best HMM Match : CH (HMM E-Value=0.0035) Length = 2440 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +1 Query: 115 KRDAPKEDNSLNTLAESAKKTIEELREKVESALAPETVKK 234 KRDAP DN S KK L +E+ +P + K Sbjct: 780 KRDAPLRDNDEQFRTYSRKKQHASLESSIEAPCSPRSASK 819 >SB_36932| Best HMM Match : HTH_8 (HMM E-Value=1.4) Length = 721 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 115 KRDAPKEDNSLNTLAESAKKTIEELREKVE 204 KR APK+ N+ + L +K EELR++ + Sbjct: 62 KRQAPKDRNTASVLRAKIRKQEEELRKETQ 91 >SB_49607| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4538 Score = 27.5 bits (58), Expect = 5.7 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -3 Query: 393 ENFYSIMSRTLLHSIYLGL 337 E +SIMS LLH ++LGL Sbjct: 3818 EEMFSIMSSVLLHLVFLGL 3836 >SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) Length = 2155 Score = 27.1 bits (57), Expect = 7.6 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +1 Query: 112 VKRDAPKEDNSLNTLAESAKKTIEELREKVESAL 213 ++R ++DN L ++ E K T EEL+ +E + Sbjct: 172 LQRQLSQKDNQLQSMKEDVKNTEEELKLDLEKVI 205 >SB_18070| Best HMM Match : V-ATPase_G (HMM E-Value=4) Length = 166 Score = 26.6 bits (56), Expect = 10.0 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +1 Query: 103 HAFVKRDAPKEDNSLNTLAESAKKTIEELREKVESALAPETVKKNFGTMVDSFNEFYKNL 282 H D K + E KK + ++RE+ S L P + SF + + Sbjct: 80 HGLASHDKKKRERPSLVARERMKKRLRKIREEFGSELLPIVYVREIVLAYISFCRLFMYV 139 Query: 283 KP 288 KP Sbjct: 140 KP 141 >SB_15093| Best HMM Match : Rho_N (HMM E-Value=8.1e-05) Length = 315 Score = 26.6 bits (56), Expect = 10.0 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +1 Query: 148 NTLAESAKKTIEELREKVESALAPETVKKNFGTMVDSFNE 267 N A S KK + + + + S PE +KK VDS E Sbjct: 81 NRAANSVKKELNKFADWILS-FVPEPIKKTVNKQVDSLKE 119 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,155,020 Number of Sequences: 59808 Number of extensions: 198139 Number of successful extensions: 558 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 558 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 945255773 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -