BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_N14 (654 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC7D4.05 |||hydrolase |Schizosaccharomyces pombe|chr 1|||Manual 29 0.59 SPAC688.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 26 4.1 >SPAC7D4.05 |||hydrolase |Schizosaccharomyces pombe|chr 1|||Manual Length = 225 Score = 29.1 bits (62), Expect = 0.59 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 199 IRLVTFDATNTLLKFKMVPSQYYTKIARTYG 291 I+LVTFDA T+L Y+++A+ YG Sbjct: 10 IKLVTFDAFGTILHLSKPVPIVYSEVAQKYG 40 >SPAC688.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1038 Score = 26.2 bits (55), Expect = 4.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -3 Query: 589 SEFENHSYSYPXXFYYXQQCIASSRYIPT 503 SE EN+ +SYP F Y + +S + T Sbjct: 92 SENENYDFSYPGTFVYRKAASSSHETLAT 120 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,324,506 Number of Sequences: 5004 Number of extensions: 43424 Number of successful extensions: 86 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -