BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_N13 (423 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2A9.02 |||NAD dependent epimerase/dehydratase family protein... 29 0.23 SPBC19G7.03c |rps3002|rps30-2, rps30|40S ribosomal protein S30|S... 26 2.1 SPAC19B12.04 |rps3001|rps30-1|40S ribosomal protein S30|Schizosa... 26 2.1 SPCC794.04c |||membrane transporter|Schizosaccharomyces pombe|ch... 25 4.8 SPCC1682.07 |ssl1||transcription factor TFIIH complex subunit Ss... 25 4.8 SPBC56F2.11 |met6||homoserine O-acetyltransferase|Schizosaccharo... 25 6.4 SPCC4G3.19 |alp16||gamma tubulin complex subunit Alp16 |Schizosa... 24 8.5 SPAC8C9.15c |tif225||translation initiation factor eIF2B epsilon... 24 8.5 >SPBC2A9.02 |||NAD dependent epimerase/dehydratase family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 295 Score = 29.5 bits (63), Expect = 0.23 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 Query: 232 WXGVHWSDARNAFVLLLQLAMKTLLYHYV 146 W VH +DA N FVL L+ +YH V Sbjct: 192 WPAVHRTDAANLFVLALEKETAGSIYHAV 220 >SPBC19G7.03c |rps3002|rps30-2, rps30|40S ribosomal protein S30|Schizosaccharomyces pombe|chr 2|||Manual Length = 61 Score = 26.2 bits (55), Expect = 2.1 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -1 Query: 63 KCTGSLARAGKVKGPNP 13 K GSLARAGKVK P Sbjct: 3 KVHGSLARAGKVKSQTP 19 >SPAC19B12.04 |rps3001|rps30-1|40S ribosomal protein S30|Schizosaccharomyces pombe|chr 1|||Manual Length = 61 Score = 26.2 bits (55), Expect = 2.1 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -1 Query: 63 KCTGSLARAGKVKGPNP 13 K GSLARAGKVK P Sbjct: 3 KVHGSLARAGKVKSQTP 19 >SPCC794.04c |||membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 547 Score = 25.0 bits (52), Expect = 4.8 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +1 Query: 307 TSKKKHACRSTLQDHGHSCFLCEWPNGTRPVAP 405 T + T D G + EW +G P+AP Sbjct: 67 TRSSDNTTSDTEDDSGEDSYQVEWESGKDPLAP 99 >SPCC1682.07 |ssl1||transcription factor TFIIH complex subunit Ssl1|Schizosaccharomyces pombe|chr 3|||Manual Length = 421 Score = 25.0 bits (52), Expect = 4.8 Identities = 13/52 (25%), Positives = 19/52 (36%) Frame = +1 Query: 250 CRLPSDMQLHIVKSYQPSLTSKKKHACRSTLQDHGHSCFLCEWPNGTRPVAP 405 C L + H+ +SY K + CF C+ P PV+P Sbjct: 328 CSLVLILSTHLARSYHHLFPLKNWSEIPWSANPKSTHCFACQLPFPKPPVSP 379 >SPBC56F2.11 |met6||homoserine O-acetyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 489 Score = 24.6 bits (51), Expect = 6.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 17 FGPLTLPARAKDPVHF 64 +GPL P RA DP HF Sbjct: 85 WGPLLGPGRAFDPSHF 100 >SPCC4G3.19 |alp16||gamma tubulin complex subunit Alp16 |Schizosaccharomyces pombe|chr 3|||Manual Length = 759 Score = 24.2 bits (50), Expect = 8.5 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -3 Query: 316 FYLSG-LVDKILQYAVAYQRAIDTRPGRQWXGVHWSDARNAFVLLLQLAMKTLL 158 FYLS +V+ +LQY +QR + R++ + S+ N+F +L L+ Sbjct: 256 FYLSNFIVNGVLQYRKEFQRWLRLYEFRRFGLIGLSNFVNSFSSFFELISHFLI 309 >SPAC8C9.15c |tif225||translation initiation factor eIF2B epsilon subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 678 Score = 24.2 bits (50), Expect = 8.5 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 91 LVQMMRAHRQRHESSKGAPHNDRVRSSSP 177 L ++++ HR+R E K A VR +SP Sbjct: 136 LNEVLKEHRKRREDDKNAIMTMVVREASP 164 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,790,746 Number of Sequences: 5004 Number of extensions: 33884 Number of successful extensions: 86 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 150383836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -