BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_N13 (423 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38587| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.024 SB_24533| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.042 SB_42207| Best HMM Match : Ank (HMM E-Value=6.3) 34 0.056 SB_33616| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.056 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.056 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 33 0.098 SB_50168| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_13755| Best HMM Match : Cyto_ox_2 (HMM E-Value=5.5e-09) 33 0.13 SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 32 0.17 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 32 0.17 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 32 0.17 SB_17826| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.17 SB_6812| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.17 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 32 0.23 SB_33552| Best HMM Match : MIF (HMM E-Value=9.7) 32 0.23 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 31 0.30 SB_41480| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_38636| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_36790| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 31 0.30 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 31 0.30 SB_31742| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_30562| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_26344| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 31 0.30 SB_11590| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_9170| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 31 0.30 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_1641| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_59544| Best HMM Match : Secretin_N_2 (HMM E-Value=7.9) 31 0.30 SB_59174| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_59049| Best HMM Match : NUMOD1 (HMM E-Value=6) 31 0.30 SB_56976| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_55903| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_55293| Best HMM Match : Hemopexin (HMM E-Value=6.7) 31 0.30 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 31 0.30 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_41348| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_40846| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_38671| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 31 0.30 SB_36182| Best HMM Match : Fic (HMM E-Value=2.3e-19) 31 0.30 SB_35762| Best HMM Match : Beta-lactamase (HMM E-Value=7.2e-05) 31 0.30 SB_34299| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_34022| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_33362| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 31 0.30 SB_18725| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_16932| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_16803| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_14402| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_14049| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_13220| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_10480| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_10241| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_9002| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_3366| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.30 SB_57373| Best HMM Match : DUF292 (HMM E-Value=4.7) 31 0.39 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 0.46 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.91 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.91 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.8 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 2.9 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 2.9 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 2.9 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 2.9 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 2.9 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 2.9 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 2.9 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 2.9 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 3.0 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 3.0 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 3.0 SB_40704| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_33497| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_31040| Best HMM Match : PAN (HMM E-Value=0.00021) 27 8.5 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 27 8.5 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 27 8.5 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_21816| Best HMM Match : DUF1279 (HMM E-Value=1.1) 27 8.5 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 27 8.5 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_20760| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 >SB_38587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 35.1 bits (77), Expect = 0.024 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +1 Query: 295 QPSLTSKKKHACRSTLQDHGHSCFLCE 375 +P L + + R+ +++HGHSCFLCE Sbjct: 113 KPELRKRDGNGYRARIRNHGHSCFLCE 139 >SB_24533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 34.3 bits (75), Expect = 0.042 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +1 Query: 232 IDVQDVCRLPSDMQLHIVKSYQPSLTSKKKHACRSTLQDHGHSCFLCE 375 I D+ LP+D + Y+ +LT R+ +++HGHSCFLCE Sbjct: 5 IHQSDLLFLPTD------RGYKYALTVVDVAGYRARIRNHGHSCFLCE 46 >SB_42207| Best HMM Match : Ank (HMM E-Value=6.3) Length = 71 Score = 33.9 bits (74), Expect = 0.056 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 322 HACRSTLQDHGHSCFLCE 375 H R+ +++HGHSCFLCE Sbjct: 39 HGYRARIRNHGHSCFLCE 56 >SB_33616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 33.9 bits (74), Expect = 0.056 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +1 Query: 316 KKHACRSTLQDHGHSCFLCE 375 KK R+ +++HGHSCFLCE Sbjct: 53 KKGGYRARIRNHGHSCFLCE 72 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 33.9 bits (74), Expect = 0.056 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 322 HACRSTLQDHGHSCFLCE 375 H R+ +++HGHSCFLCE Sbjct: 148 HGYRARIRNHGHSCFLCE 165 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 33.1 bits (72), Expect = 0.098 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 316 KKHACRSTLQDHGHSCFLCE 375 +K R+ +++HGHSCFLCE Sbjct: 130 EKQGYRARIRNHGHSCFLCE 149 >SB_50168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 32.7 bits (71), Expect = 0.13 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 5/63 (7%) Frame = +1 Query: 202 SLHLTNGLLXIDVQDVCRLPSDMQLHIVKSYQPSLTSK-----KKHACRSTLQDHGHSCF 366 ++ L + L ++ + PSD + K +LT + + R+ +++HGHSCF Sbjct: 26 AVSLASELAENTIESLSAQPSDRNAGLDKGSWVALTVEGSTLANPNGYRARIRNHGHSCF 85 Query: 367 LCE 375 LCE Sbjct: 86 LCE 88 >SB_13755| Best HMM Match : Cyto_ox_2 (HMM E-Value=5.5e-09) Length = 194 Score = 32.7 bits (71), Expect = 0.13 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 298 PSLTSKKKHACRSTLQDHGHSCFLCE 375 P L + R+ +++HGHSCFLCE Sbjct: 154 PMLKTVAVQGYRARIRNHGHSCFLCE 179 >SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 32.7 bits (71), Expect = 0.13 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 301 SLTSKKKHACRSTLQDHGHSCFLCE 375 S + K R+ +++HGHSCFLCE Sbjct: 648 SFATLYKKGYRARIRNHGHSCFLCE 672 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 32.3 bits (70), Expect = 0.17 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 301 SLTSKKKHACRSTLQDHGHSCFLCE 375 +L K R+ +++HGHSCFLCE Sbjct: 250 NLNQIKLDGYRARIRNHGHSCFLCE 274 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 32.3 bits (70), Expect = 0.17 Identities = 13/30 (43%), Positives = 21/30 (70%), Gaps = 3/30 (10%) Frame = +1 Query: 295 QPSLTSKKKH---ACRSTLQDHGHSCFLCE 375 +PSL+ + + R+ +++HGHSCFLCE Sbjct: 156 EPSLSREDRQFLEGYRARIRNHGHSCFLCE 185 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 32.3 bits (70), Expect = 0.17 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 2/28 (7%) Frame = +1 Query: 298 PSLTSKKK--HACRSTLQDHGHSCFLCE 375 P L +K++ R+ +++HGHSCFLCE Sbjct: 115 PRLPAKERLVDGYRARIRNHGHSCFLCE 142 >SB_17826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 32.3 bits (70), Expect = 0.17 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 271 QLHIVKSYQPSLTSKKKHACRSTLQDHGHSCFLCE 375 QLH + S T K R+ +++HGHSCFLCE Sbjct: 51 QLHSKRKATIS-TPIKIDGYRARIRNHGHSCFLCE 84 >SB_6812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 32.3 bits (70), Expect = 0.17 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 316 KKHACRSTLQDHGHSCFLCE 375 K R+ +++HGHSCFLCE Sbjct: 151 KTRGYRARIRNHGHSCFLCE 170 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 31.9 bits (69), Expect = 0.23 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +1 Query: 307 TSKKKHACRSTLQDHGHSCFLCE 375 +++ R+ +++HGHSCFLCE Sbjct: 211 STRSTRGYRARIRNHGHSCFLCE 233 >SB_33552| Best HMM Match : MIF (HMM E-Value=9.7) Length = 148 Score = 31.9 bits (69), Expect = 0.23 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 307 TSKKKHACRSTLQDHGHSCFLCE 375 T R+ +++HGHSCFLCE Sbjct: 111 TKMMSQGYRARIRNHGHSCFLCE 133 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 112 RARIRNHGHSCFLCE 126 >SB_41480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 76 RARIRNHGHSCFLCE 90 >SB_38636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 47 RARIRNHGHSCFLCE 61 >SB_36790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 28 RARIRNHGHSCFLCE 42 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 211 RARIRNHGHSCFLCE 225 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 114 RARIRNHGHSCFLCE 128 >SB_31742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 43 RARIRNHGHSCFLCE 57 >SB_30562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 67 RARIRNHGHSCFLCE 81 >SB_26344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 77 RARIRNHGHSCFLCE 91 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 189 RARIRNHGHSCFLCE 203 >SB_11590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 72 RARIRNHGHSCFLCE 86 >SB_9170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 44 RARIRNHGHSCFLCE 58 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 108 RARIRNHGHSCFLCE 122 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 130 RARIRNHGHSCFLCE 144 >SB_1641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 59 RARIRNHGHSCFLCE 73 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 126 RARIRNHGHSCFLCE 140 >SB_59544| Best HMM Match : Secretin_N_2 (HMM E-Value=7.9) Length = 158 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 129 RARIRNHGHSCFLCE 143 >SB_59174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 31 RARIRNHGHSCFLCE 45 >SB_59049| Best HMM Match : NUMOD1 (HMM E-Value=6) Length = 77 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 48 RARIRNHGHSCFLCE 62 >SB_56976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 73 RARIRNHGHSCFLCE 87 >SB_55903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 60 RARIRNHGHSCFLCE 74 >SB_55293| Best HMM Match : Hemopexin (HMM E-Value=6.7) Length = 64 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 35 RARIRNHGHSCFLCE 49 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 166 RARIRNHGHSCFLCE 180 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 162 RARIRNHGHSCFLCE 176 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 138 RARIRNHGHSCFLCE 152 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 195 RARIRNHGHSCFLCE 209 >SB_41348| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 12 RARIRNHGHSCFLCE 26 >SB_40846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 59 RARIRNHGHSCFLCE 73 >SB_38671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 38 RARIRNHGHSCFLCE 52 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 101 RARIRNHGHSCFLCE 115 >SB_36182| Best HMM Match : Fic (HMM E-Value=2.3e-19) Length = 181 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 152 RARIRNHGHSCFLCE 166 >SB_35762| Best HMM Match : Beta-lactamase (HMM E-Value=7.2e-05) Length = 166 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 137 RARIRNHGHSCFLCE 151 >SB_34299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 59 RARIRNHGHSCFLCE 73 >SB_34022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 100 RARIRNHGHSCFLCE 114 >SB_33362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 117 RARIRNHGHSCFLCE 131 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 123 RARIRNHGHSCFLCE 137 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 111 RARIRNHGHSCFLCE 125 >SB_18725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 76 RARIRNHGHSCFLCE 90 >SB_16932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 37 RARIRNHGHSCFLCE 51 >SB_16803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 18 RARIRNHGHSCFLCE 32 >SB_14402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 27 RARIRNHGHSCFLCE 41 >SB_14049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 101 RARIRNHGHSCFLCE 115 >SB_13220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 53 RARIRNHGHSCFLCE 67 >SB_10480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 31 RARIRNHGHSCFLCE 45 >SB_10241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 126 RARIRNHGHSCFLCE 140 >SB_9002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 43 RARIRNHGHSCFLCE 57 >SB_3366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 31.5 bits (68), Expect = 0.30 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 331 RSTLQDHGHSCFLCE 375 R+ +++HGHSCFLCE Sbjct: 82 RARIRNHGHSCFLCE 96 >SB_57373| Best HMM Match : DUF292 (HMM E-Value=4.7) Length = 383 Score = 31.1 bits (67), Expect = 0.39 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 9/63 (14%) Frame = -3 Query: 298 VDKILQYAVAY-QRAIDTRPG------RQWXGVHWSDARNAFVL--LLQLAMKTLLYHYV 146 VD+ +Q A+ Y Q+ +P RQW G + DA+ +F L L + +++L Y ++ Sbjct: 258 VDETIQQALLYEQKKFLAQPNIHRLVERQWSGALFGDAKTSFKLFMFLLIVLESLFYPFL 317 Query: 145 EPL 137 PL Sbjct: 318 LPL 320 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.9 bits (59), Expect(2) = 0.46 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 358 YDHDPVEXTCRHAFFYLSGLVDK 290 Y+ DP+E TCRHA L+ ++ + Sbjct: 53 YEGDPLESTCRHASLALAVVLQR 75 Score = 21.8 bits (44), Expect(2) = 0.46 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 370 TGNSYDHD 347 +GNSYDHD Sbjct: 16 SGNSYDHD 23 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 0.91 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 376 IHTGNSYDHDPVEXTCRHAFFYLSGLVDK 290 +H G D DP+E TCRHA L+ ++ + Sbjct: 15 LHPGVIRDGDPLESTCRHASLALAVVLQR 43 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 29.9 bits (64), Expect = 0.91 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -3 Query: 364 NSYDHDPVEXTCRHAFFYLSGLVDK 290 N Y+ DP+E TCRHA L+ ++ + Sbjct: 138 NRYEGDPLESTCRHASLALAVVLQR 162 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 29.5 bits (63), Expect = 1.2 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = -3 Query: 385 HSAIHTGNSYDHDPVEXTCRHAFFYLSGLVDK 290 H+++H NS DP+E TCRHA L+ ++ + Sbjct: 73 HNSLH--NSTRGDPLESTCRHASLALAVVLQR 102 >SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 392 Score = 29.5 bits (63), Expect = 1.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 382 SAIHTGNSYDHDPVEXTCRHAFFYLSGLVDK 290 S I SY DP+E TCRHA L+ ++ + Sbjct: 277 SQITAPESYKGDPLESTCRHASLALAVVLQR 307 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 29.5 bits (63), Expect = 1.2 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -3 Query: 370 TGNSYDHDPVEXTCRHAFFYLSGLVDK 290 TG+SY DP+E TCRHA L+ ++ + Sbjct: 3 TGHSYG-DPLESTCRHASLALAVVLQR 28 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 29.1 bits (62), Expect = 1.6 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 379 AIHTGNSYDHDPVEXTCRHAFFYLSGLVDK 290 A H G+ DP+E TCRHA L+ ++ + Sbjct: 65 AAHLGDLLRGDPLESTCRHASLALAVVLQR 94 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.1 bits (62), Expect = 1.6 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -3 Query: 400 LQGASHSAIHTGNSYDHDPVEXTCRHAFFYLSGLVDK 290 +QG +H A+ G DP+E TCRHA L+ ++ + Sbjct: 36 VQGIAHMALTVG-----DPLESTCRHASLALAVVLQR 67 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 2.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 364 NSYDHDPVEXTCRHAFFYLSGLVDK 290 N D DP+E TCRHA L+ ++ + Sbjct: 76 NGEDGDPLESTCRHASLALAVVLQR 100 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 25.0 bits (52), Expect(2) = 2.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 349 DPVEXTCRHAFFYLSGLVDK 290 DP+E TCRHA L+ ++ + Sbjct: 62 DPLESTCRHASLALAVVLQR 81 Score = 21.8 bits (44), Expect(2) = 2.9 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 370 TGNSYDHD 347 +GNSYDHD Sbjct: 16 SGNSYDHD 23 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 25.0 bits (52), Expect(2) = 2.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 349 DPVEXTCRHAFFYLSGLVDK 290 DP+E TCRHA L+ ++ + Sbjct: 57 DPLESTCRHASLALAVVLQR 76 Score = 21.8 bits (44), Expect(2) = 2.9 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 370 TGNSYDHD 347 +GNSYDHD Sbjct: 16 SGNSYDHD 23 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 25.0 bits (52), Expect(2) = 2.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 349 DPVEXTCRHAFFYLSGLVDK 290 DP+E TCRHA L+ ++ + Sbjct: 57 DPLESTCRHASLALAVVLQR 76 Score = 21.8 bits (44), Expect(2) = 2.9 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 370 TGNSYDHD 347 +GNSYDHD Sbjct: 16 SGNSYDHD 23 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 25.0 bits (52), Expect(2) = 2.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 349 DPVEXTCRHAFFYLSGLVDK 290 DP+E TCRHA L+ ++ + Sbjct: 56 DPLESTCRHASLALAVVLQR 75 Score = 21.8 bits (44), Expect(2) = 2.9 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 370 TGNSYDHD 347 +GNSYDHD Sbjct: 16 SGNSYDHD 23 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 25.0 bits (52), Expect(2) = 2.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 349 DPVEXTCRHAFFYLSGLVDK 290 DP+E TCRHA L+ ++ + Sbjct: 44 DPLESTCRHASLALAVVLQR 63 Score = 21.8 bits (44), Expect(2) = 2.9 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 370 TGNSYDHD 347 +GNSYDHD Sbjct: 16 SGNSYDHD 23 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 25.0 bits (52), Expect(2) = 2.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 349 DPVEXTCRHAFFYLSGLVDK 290 DP+E TCRHA L+ ++ + Sbjct: 50 DPLESTCRHASLALAVVLQR 69 Score = 21.8 bits (44), Expect(2) = 2.9 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 370 TGNSYDHD 347 +GNSYDHD Sbjct: 16 SGNSYDHD 23 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 25.0 bits (52), Expect(2) = 2.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 349 DPVEXTCRHAFFYLSGLVDK 290 DP+E TCRHA L+ ++ + Sbjct: 52 DPLESTCRHASLALAVVLQR 71 Score = 21.8 bits (44), Expect(2) = 2.9 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 370 TGNSYDHD 347 +GNSYDHD Sbjct: 16 SGNSYDHD 23 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 25.0 bits (52), Expect(2) = 2.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 349 DPVEXTCRHAFFYLSGLVDK 290 DP+E TCRHA L+ ++ + Sbjct: 50 DPLESTCRHASLALAVVLQR 69 Score = 21.8 bits (44), Expect(2) = 2.9 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 370 TGNSYDHD 347 +GNSYDHD Sbjct: 16 SGNSYDHD 23 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 25.0 bits (52), Expect(2) = 3.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 349 DPVEXTCRHAFFYLSGLVDK 290 DP+E TCRHA L+ ++ + Sbjct: 49 DPLESTCRHASLALAVVLQR 68 Score = 21.8 bits (44), Expect(2) = 3.0 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 370 TGNSYDHD 347 +GNSYDHD Sbjct: 16 SGNSYDHD 23 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 25.0 bits (52), Expect(2) = 3.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 349 DPVEXTCRHAFFYLSGLVDK 290 DP+E TCRHA L+ ++ + Sbjct: 43 DPLESTCRHASLALAVVLQR 62 Score = 21.8 bits (44), Expect(2) = 3.0 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 370 TGNSYDHD 347 +GNSYDHD Sbjct: 16 SGNSYDHD 23 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 25.0 bits (52), Expect(2) = 3.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 349 DPVEXTCRHAFFYLSGLVDK 290 DP+E TCRHA L+ ++ + Sbjct: 45 DPLESTCRHASLALAVVLQR 64 Score = 21.8 bits (44), Expect(2) = 3.0 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 370 TGNSYDHD 347 +GNSYDHD Sbjct: 16 SGNSYDHD 23 >SB_40704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 27.9 bits (59), Expect = 3.7 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = +1 Query: 13 GVWSF--DFTCTSQRSCALYHQA 75 GVW + D TCT QR A YH + Sbjct: 193 GVWPYRVDLTCTRQRDLAGYHNS 215 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 27.5 bits (58), Expect = 4.8 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -3 Query: 391 ASHSAIHTGNSYDHDPVEXTCRHAFFYLSGLVDK 290 A HS G DP+E TCRHA L+ ++ + Sbjct: 13 ARHSRRSNGPVAAGDPLESTCRHASLALAVVLQR 46 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect = 4.8 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 394 GASHSAIHTGNSYDHDPVEXTCRHAFFYLSGLVDK 290 G H TG + DP+E TCRHA L+ ++ + Sbjct: 40 GGGHKDHTTGTTVG-DPLESTCRHASLALAVVLQR 73 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 27.5 bits (58), Expect = 4.8 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -3 Query: 391 ASHSAIHTGNSYDHDPVEXTCRHAFFYLSGLVDK 290 + S +H + + DP+E TCRHA L+ ++ + Sbjct: 5 SDRSRLHFHFASEGDPLESTCRHASLALAVVLQR 38 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 27.5 bits (58), Expect = 4.8 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 4/33 (12%) Frame = -3 Query: 376 IHTGN----SYDHDPVEXTCRHAFFYLSGLVDK 290 IHT N S+ DP+E TCRHA L+ ++ + Sbjct: 53 IHTENQNQVSFYGDPLESTCRHASLALAVVLQR 85 >SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 27.5 bits (58), Expect = 4.8 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 358 YDHDPVEXTCRHAFFYLSGLVDK 290 +D DP+E TCRHA L+ ++ + Sbjct: 47 HDGDPLESTCRHASLALAVVLQR 69 >SB_33497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 27.5 bits (58), Expect = 4.8 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 133 SKGAPHNDRVRSSSPTAARVRMRS 204 ++G+PH R R+SSP AR R S Sbjct: 728 ARGSPHQPRGRASSPGGARGRAAS 751 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.1 bits (57), Expect = 6.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 Query: 373 HTGNSYDHDPVEXTCRHAFFYLSGLVDK 290 +T Y DP+E TCRHA L+ ++ + Sbjct: 63 NTLQHYHGDPLESTCRHASLALAVVLQR 90 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 27.1 bits (57), Expect = 6.4 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -3 Query: 367 GNSYDH-DPVEXTCRHAFFYLSGLVDK 290 G YD DP+E TCRHA L+ ++ + Sbjct: 27 GLKYDEGDPLESTCRHASLALAVVLQR 53 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 27.1 bits (57), Expect = 6.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 Query: 373 HTGNSYDHDPVEXTCRHAFFYLSGLVDK 290 H +S DP+E TCRHA L+ ++ + Sbjct: 16 HLKSSLRGDPLESTCRHASLALAVVLQR 43 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 26.6 bits (56), Expect = 8.5 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 382 SAIHTGNSYDHDPVEXTCRHAFFYLSGLVDK 290 +A+H DP+E TCRHA L+ ++ + Sbjct: 108 TAVHMEPFSTGDPLESTCRHASLALAVVLQR 138 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 26.6 bits (56), Expect = 8.5 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 355 DHDPVEXTCRHAFFYLSGLVDK 290 D DP+E TCRHA L+ ++ + Sbjct: 6 DGDPLESTCRHASLALAVVLQR 27 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 26.6 bits (56), Expect = 8.5 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 355 DHDPVEXTCRHAFFYLSGLVDK 290 D DP+E TCRHA L+ ++ + Sbjct: 45 DGDPLESTCRHASLALAVVLQR 66 >SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 26.6 bits (56), Expect = 8.5 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 355 DHDPVEXTCRHAFFYLSGLVDK 290 D DP+E TCRHA L+ ++ + Sbjct: 5 DGDPLESTCRHASLALAVVLQR 26 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 26.6 bits (56), Expect = 8.5 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 376 IHTGNSYDHDPVEXTCRHAFFYLSGLVDK 290 +HTG DP+E TCRHA L+ ++ + Sbjct: 21 LHTGG----DPLESTCRHASLALAVVLQR 45 >SB_31040| Best HMM Match : PAN (HMM E-Value=0.00021) Length = 661 Score = 26.6 bits (56), Expect = 8.5 Identities = 13/60 (21%), Positives = 29/60 (48%) Frame = -1 Query: 294 IRFYNMQLHIRGQSTHVLDVNGQESIGQMQGTHSYSCCSWR*RPYSIIMWSPFR*FMSLS 115 + F +++ + STH++++ ++ G+ G H C + +S++ FR F S Sbjct: 30 VPFKSIENRGKTSSTHIVEILSKQKNGESHGLHFIQICDY----FSVVQRMHFRHFSHYS 85 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 26.6 bits (56), Expect = 8.5 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 355 DHDPVEXTCRHAFFYLSGLVDK 290 D DP+E TCRHA L+ ++ + Sbjct: 251 DGDPLESTCRHASLALAVVLQR 272 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 26.6 bits (56), Expect = 8.5 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 355 DHDPVEXTCRHAFFYLSGLVDK 290 D DP+E TCRHA L+ ++ + Sbjct: 5 DGDPLESTCRHASLALAVVLQR 26 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 26.6 bits (56), Expect = 8.5 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 355 DHDPVEXTCRHAFFYLSGLVDK 290 D DP+E TCRHA L+ ++ + Sbjct: 89 DGDPLESTCRHASLALAVVLQR 110 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 26.6 bits (56), Expect = 8.5 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 355 DHDPVEXTCRHAFFYLSGLVDK 290 D DP+E TCRHA L+ ++ + Sbjct: 68 DGDPLESTCRHASLALAVVLQR 89 >SB_21816| Best HMM Match : DUF1279 (HMM E-Value=1.1) Length = 894 Score = 26.6 bits (56), Expect = 8.5 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +1 Query: 247 VCRLPSD--MQLHIVKSYQPSLTSKKKHACRS 336 VC LP + +H+++ Y + TS + HA S Sbjct: 174 VCVLPGEGYRNVHVIRGYDTANTSSRTHAAHS 205 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 26.6 bits (56), Expect = 8.5 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 355 DHDPVEXTCRHAFFYLSGLVDK 290 D DP+E TCRHA L+ ++ + Sbjct: 111 DGDPLESTCRHASLALAVVLQR 132 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 26.6 bits (56), Expect = 8.5 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 355 DHDPVEXTCRHAFFYLSGLVDK 290 D DP+E TCRHA L+ ++ + Sbjct: 39 DGDPLESTCRHASLALAVVLQR 60 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 26.6 bits (56), Expect = 8.5 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 Query: 400 LQGASHSAIHTGNSYDHDPVEXTCRHAFFYLSGLVDK 290 L A +H S DP+E TCRHA L+ ++ + Sbjct: 42 LHVAGEKRLHRCVSRIGDPLESTCRHASLALAVVLQR 78 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 26.6 bits (56), Expect = 8.5 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 355 DHDPVEXTCRHAFFYLSGLVDK 290 D DP+E TCRHA L+ ++ + Sbjct: 20 DGDPLESTCRHASLALAVVLQR 41 >SB_20760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 26.6 bits (56), Expect = 8.5 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -1 Query: 198 HSYSCCSWR*RPYSIIMWSPFR*FMSLSVSSHHL 97 H+Y+ SW Y+ I WS + +++ SSH L Sbjct: 152 HNYTPISWSKHNYTTITWSKHN-YTTITWSSHQL 184 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 26.6 bits (56), Expect = 8.5 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = -3 Query: 394 GASHSAIHTGNSYDHDPVEXTCRHAFFYLSGLVDK 290 G ++S+ ++ DP+E TCRHA L+ ++ + Sbjct: 16 GNTNSSTTASSAVIGDPLESTCRHASLALAVVLQR 50 >SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 26.6 bits (56), Expect = 8.5 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -3 Query: 364 NSYDHDPVEXTCRHAFFYLSGLVDK 290 + ++ DP+E TCRHA L+ ++ + Sbjct: 2 SKFEGDPLESTCRHASLALAVVLQR 26 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,489,326 Number of Sequences: 59808 Number of extensions: 292150 Number of successful extensions: 4342 Number of sequences better than 10.0: 113 Number of HSP's better than 10.0 without gapping: 4251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4341 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 801830705 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -