BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_N10 (650 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 24 1.2 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 1.6 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 23 2.9 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 22 3.8 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 3.8 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 3.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 3.8 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 21 6.7 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 6.7 L01616-1|AAA30096.1| 74|Tribolium castaneum zinc finger protei... 21 8.8 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 21 8.8 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 8.8 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 8.8 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 23.8 bits (49), Expect = 1.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 239 MIFTNN*KSFCNPILQLDKKCV 304 +I TNN +C ++ L K CV Sbjct: 238 IILTNNQAKYCTTLIGLIKNCV 259 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.4 bits (48), Expect = 1.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 518 LRYLSMNNYLSCLHHLNVISCIF 586 LR NNY S H+L V +F Sbjct: 511 LRVQRFNNYQSLAHYLRVFFTVF 533 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 22.6 bits (46), Expect = 2.9 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +1 Query: 130 EPPXDDNNEDITEEYELLESTLDELNSALDFLE 228 EPP N D YE+LE +L D E Sbjct: 363 EPPCGQLNPDNPNVYEILEKLYKDLLELSDETE 395 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 127 IEPPXDDNNEDITEEYELLESTLDE 201 I DDN+ + E E L S +DE Sbjct: 47 IRTSEDDNDPHVNEYVESLASIIDE 71 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 127 IEPPXDDNNEDITEEYELLESTLDE 201 I DDN+ + E E L S +DE Sbjct: 361 IRTSEDDNDPHVNEYVESLASIIDE 385 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 127 IEPPXDDNNEDITEEYELLESTLDE 201 I DDN+ + E E L S +DE Sbjct: 594 IRTSEDDNDPHVNEYVESLASIIDE 618 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 127 IEPPXDDNNEDITEEYELLESTLDE 201 I DDN+ + E E L S +DE Sbjct: 594 IRTSEDDNDPHVNEYVESLASIIDE 618 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 196 DELNSALDFLERKNDDIHQQLKELLQ 273 +EL +DF R H++L E+L+ Sbjct: 95 EELRRLMDFGVRSAPSTHEELLEVLK 120 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 580 HIYVNRNEQ*HLVEHCSQKKNGS 648 H+ V+ E+ + EHCS K + S Sbjct: 209 HLRVHTGERPYGCEHCSMKFSDS 231 >L01616-1|AAA30096.1| 74|Tribolium castaneum zinc finger protein protein. Length = 74 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 580 HIYVNRNEQ*HLVEHCSQK 636 H+ V+ E+ + EHCS K Sbjct: 56 HLRVHTGERPYGCEHCSMK 74 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +2 Query: 521 RYLSMNNYLSCLHHLNVISCIFMS 592 R + N YLS L + + +C+ +S Sbjct: 134 REFASNMYLSRLRRIEIATCLRLS 157 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.0 bits (42), Expect = 8.8 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = -3 Query: 327 VVDFLIFFTHFLSNCNIGLQKLFQLLVNIIIFTLQEIQCRIK 202 ++ F++FF L++ L ++ N +F Q CR K Sbjct: 139 LIVFILFFAQGLTSPIFNLVYVYCCDNNFNVFLRQVFTCRCK 180 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = +2 Query: 272 NPILQLDKKCVKKIRKSTTVIEEMQIQHYFKFN 370 NP+ + V+K RK + + ++++ F FN Sbjct: 233 NPLEWTGQVTVRKKRKPYSKFQTLELEKEFLFN 265 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,571 Number of Sequences: 336 Number of extensions: 2490 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -