BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_M22 (655 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 24 1.5 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 24 1.5 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 24 1.5 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 22 6.0 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 22 6.0 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 22 6.0 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 23.8 bits (49), Expect = 1.5 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -1 Query: 91 LDARCATNRGRAIERTMSTSTRVGCSK 11 LD TN GR +++ + + GC+K Sbjct: 48 LDEGPCTNEGRELKKILPDALSTGCNK 74 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 23.8 bits (49), Expect = 1.5 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -1 Query: 91 LDARCATNRGRAIERTMSTSTRVGCSK 11 LD TN GR +++ + + GC+K Sbjct: 48 LDEGPCTNEGRELKKILPDALSTGCNK 74 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 23.8 bits (49), Expect = 1.5 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = +3 Query: 306 PTQGPRRKASACLSPGAAPPGQSEEMEFSPTNTLLAEFLSEKYPALESXF 455 P PR++ A G S++ + +P A S YP + S F Sbjct: 219 PGMHPRQQQQAQQHQGVVTSPLSQQQQAAPQGAASANLPSPLYPWMRSQF 268 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 126 SIITGSHFRQNTWTPD 79 ++ GS F +N W PD Sbjct: 82 TLSVGSEFIKNIWVPD 97 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 126 SIITGSHFRQNTWTPD 79 ++ GS F +N W PD Sbjct: 82 TLSVGSEFIKNIWVPD 97 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 126 SIITGSHFRQNTWTPD 79 ++ GS F +N W PD Sbjct: 21 TLSVGSEFIKNIWVPD 36 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,816 Number of Sequences: 438 Number of extensions: 3547 Number of successful extensions: 15 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -