BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_M16 (647 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 23 3.4 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 3.4 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 4.4 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 22 5.9 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 22 5.9 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 22 5.9 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 21 7.8 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 7.8 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 390 IKNMLYGTSDAEPQTDIIVAQLAQ 461 IKNM+ GTS A+ I+ A + + Sbjct: 99 IKNMITGTSQADCAVLIVAAGIGE 122 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.6 bits (46), Expect = 3.4 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 5/46 (10%) Frame = +3 Query: 267 GKSQKSPA--ELVRS---LKDAVTALERGDKKAEKAQEDVSKNLVL 389 GK ++SP ELV + +KD V ++RG+K Q+ V +++L Sbjct: 1289 GKLRQSPRLKELVGATSIIKDCVEDMKRGNKILRTCQKAVVLSMLL 1334 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = -1 Query: 434 CLWFCIRCTIKHIFNQYQILAH 369 C W C CT QYQI H Sbjct: 605 CCWHCFNCT------QYQIRDH 620 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 390 IKNMLYGTSDAEPQTDIIVA 449 IKNM+ GTS A+ I+ A Sbjct: 26 IKNMITGTSQADCAVLIVAA 45 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 390 IKNMLYGTSDAEPQTDIIVA 449 IKNM+ GTS A+ I+ A Sbjct: 42 IKNMITGTSQADCAVLIVAA 61 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 390 IKNMLYGTSDAEPQTDIIVA 449 IKNM+ GTS A+ I+ A Sbjct: 99 IKNMITGTSQADCAVLIVAA 118 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 21.4 bits (43), Expect = 7.8 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -1 Query: 44 FWINYCNFRIS 12 FW+ YCN I+ Sbjct: 48 FWLGYCNSAIN 58 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 7.8 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -1 Query: 44 FWINYCNFRIS 12 FW+ YCN I+ Sbjct: 496 FWLGYCNSAIN 506 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,676 Number of Sequences: 438 Number of extensions: 3495 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -