BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_M13 (599 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF036702-8|AAR85905.1| 377|Caenorhabditis elegans Hypothetical ... 44 1e-04 Z36752-3|CAA85325.1| 422|Caenorhabditis elegans Hypothetical pr... 29 2.5 Z81046-5|CAB02823.1| 225|Caenorhabditis elegans Hypothetical pr... 28 4.4 Z69884-4|CAA93751.2| 913|Caenorhabditis elegans Hypothetical pr... 27 7.7 >AF036702-8|AAR85905.1| 377|Caenorhabditis elegans Hypothetical protein F33D4.5 protein. Length = 377 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/69 (28%), Positives = 37/69 (53%) Frame = +3 Query: 393 PIDXVYPMKYYKWVVYTAEDAVKAHQETHHPTMFNAPDAFIFAKIEFNMTGIKQTRFMDS 572 P V+ ++K YT +A+ H+E P+++N P+A I ++E NMT +QT+ + Sbjct: 97 PTLDVFIKSHFKTQYYTVSEALDMHRELQSPSIYNNPNAPIRLRLELNMTTERQTKMVTG 156 Query: 573 FTRLSLLXH 599 + + H Sbjct: 157 SDEIVPVPH 165 >Z36752-3|CAA85325.1| 422|Caenorhabditis elegans Hypothetical protein F35H8.3 protein. Length = 422 Score = 29.1 bits (62), Expect = 2.5 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 438 YTAEDAVKAHQETHHPTMFNA 500 +T EDA++ HQ T HP F++ Sbjct: 264 FTTEDALRHHQSTAHPATFDS 284 >Z81046-5|CAB02823.1| 225|Caenorhabditis elegans Hypothetical protein C37E2.2a protein. Length = 225 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -3 Query: 150 QPWLSR-FYLYDFRFIYSFNFVLCIFY 73 QP L +Y+Y + + NFVLC+FY Sbjct: 27 QPRLGHHWYVYKLVMLTNLNFVLCVFY 53 >Z69884-4|CAA93751.2| 913|Caenorhabditis elegans Hypothetical protein F31F6.5 protein. Length = 913 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/49 (22%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = -1 Query: 449 LSRVDHPFVILHRIHXVDGYRFVLITEMLVHHCFNY---LSPSLIVRNE 312 + ++ PF++ + + G FV+ + ++ C+N+ L+P +V N+ Sbjct: 533 IGKIYGPFILSNSVRIFSGLIFVVYLAIAMYGCYNFREGLNPGNLVTND 581 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,084,093 Number of Sequences: 27780 Number of extensions: 281882 Number of successful extensions: 758 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1279376318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -