BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_M05 (652 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 26 0.31 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 24 0.94 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 24 0.94 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 24 0.94 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 24 0.94 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 0.94 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 0.94 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 24 0.94 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 24 0.94 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 25.8 bits (54), Expect = 0.31 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = -1 Query: 100 SSVLTAELVAGGFDEPPPLSRA---SMMRPGHLVF 5 S+ TAEL GG EPP + A ++PG+ VF Sbjct: 398 SAEATAELKLGGRFEPPQIRHAFNEETVQPGNSVF 432 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 24.2 bits (50), Expect = 0.94 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 Query: 219 CGHSSPGCSSLIRGELRTTVRAAKNNTT 136 C SPGC SL RG+ K TT Sbjct: 223 CVLCSPGCFSLFRGKALMDKSVMKKYTT 250 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 24.2 bits (50), Expect = 0.94 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 Query: 219 CGHSSPGCSSLIRGELRTTVRAAKNNTT 136 C SPGC SL RG+ K TT Sbjct: 537 CVLCSPGCFSLFRGKALMDKSVMKKYTT 564 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 24.2 bits (50), Expect = 0.94 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 Query: 219 CGHSSPGCSSLIRGELRTTVRAAKNNTT 136 C SPGC SL RG+ K TT Sbjct: 797 CVLCSPGCFSLFRGKALMDDNVMKKYTT 824 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 24.2 bits (50), Expect = 0.94 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 Query: 219 CGHSSPGCSSLIRGELRTTVRAAKNNTT 136 C SPGC SL RG+ K TT Sbjct: 797 CVLCSPGCFSLFRGKALMDDNVMKKYTT 824 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 24.2 bits (50), Expect = 0.94 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 Query: 219 CGHSSPGCSSLIRGELRTTVRAAKNNTT 136 C SPGC SL RG+ K TT Sbjct: 770 CVLCSPGCFSLFRGKALMDKSVMKKYTT 797 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 24.2 bits (50), Expect = 0.94 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 Query: 219 CGHSSPGCSSLIRGELRTTVRAAKNNTT 136 C SPGC SL RG+ K TT Sbjct: 770 CVLCSPGCFSLFRGKALMDKSVMKKYTT 797 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 24.2 bits (50), Expect = 0.94 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 Query: 219 CGHSSPGCSSLIRGELRTTVRAAKNNTT 136 C SPGC SL RG+ K TT Sbjct: 797 CVLCSPGCFSLFRGKALMDDNVMKKYTT 824 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 24.2 bits (50), Expect = 0.94 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 Query: 219 CGHSSPGCSSLIRGELRTTVRAAKNNTT 136 C SPGC SL RG+ K TT Sbjct: 797 CVLCSPGCFSLFRGKALMDDNVMKKYTT 824 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,163 Number of Sequences: 336 Number of extensions: 2631 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -