Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P01_F_M05
         (652 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              24   1.1  
AF144379-1|AAD34586.1|  543|Apis mellifera glutamate transporter...    22   5.9  

>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 3/35 (8%)
 Frame = -1

Query: 100 SSVLTAELVAGGFDEPPPLSRA---SMMRPGHLVF 5
           S+  TAEL  GG  EPP + +A     ++PG  +F
Sbjct: 378 SAQATAELKLGGRFEPPQIRQAFAEETLQPGPSMF 412


>AF144379-1|AAD34586.1|  543|Apis mellifera glutamate transporter
           Am-EAAT protein.
          Length = 543

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = -2

Query: 531 VIFCTTFGLI 502
           ++FC TFGL+
Sbjct: 244 IVFCITFGLV 253


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 170,262
Number of Sequences: 438
Number of extensions: 3731
Number of successful extensions: 8
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19682733
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)