BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_M03 (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. 26 1.2 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 8.3 >AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. Length = 356 Score = 25.8 bits (54), Expect = 1.2 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 3/22 (13%) Frame = +2 Query: 377 HTNLLSSKAADNQ---TWTQPW 433 H N+L AADN+ TWTQ W Sbjct: 110 HENILGFIAADNKDNGTWTQLW 131 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.0 bits (47), Expect = 8.3 Identities = 10/42 (23%), Positives = 18/42 (42%) Frame = -2 Query: 641 FNRDTFXISIPKFYRIFCIVRNNNKLL*TRCNNFFL*QTPSP 516 + +D +P Y +V N N+L + N+ + P P Sbjct: 767 YGKDNPHFHVPSLYGFQQVVNNTNRLYTPQLNHISMRMPPVP 808 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 559,060 Number of Sequences: 2352 Number of extensions: 10343 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -