BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_L19 (395 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 26 0.44 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 22 9.4 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 26.2 bits (55), Expect = 0.44 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Frame = +1 Query: 34 TCLCGVAPELNQCHFVPGRIQSHCVSRGSASXRPPSWSPLGRGC----CQLQNGFV 189 TC G +L++ H P +QS C SW+ GC C +NGF+ Sbjct: 170 TCPEGFEAQLSEQHCCPQCVQSQCKFNDQFYREGQSWAS-PDGCIVYRCVKENGFL 224 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 21.8 bits (44), Expect = 9.4 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = -1 Query: 182 PFCSWQQPRPSGDQDGGRXDADPRETQWDCIRPGT 78 P W QP PS Q+G ++ ++ + GT Sbjct: 519 PSNGWVQPVPSHTQNGPSQPQPQQQNPFNLLNFGT 553 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 362,789 Number of Sequences: 2352 Number of extensions: 6864 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31212099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -