BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_L17 (640 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 28 4.5 At2g10110.1 68415.m01050 hypothetical protein 28 6.0 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 28.3 bits (60), Expect = 4.5 Identities = 15/58 (25%), Positives = 29/58 (50%) Frame = +2 Query: 452 RLLQVELCRNIALIHEENGYDCMDVXNRPRGCAVFKHAYRGTVPCGE*PFDISENQQG 625 ++L V + + L ++ ++C R + C FK + +PCG+ P I +Q+G Sbjct: 416 KILDVGMNCILDLTNQRTPWECAKFFLRKQSCPNFKSFFY--LPCGKDPHRIKPDQEG 471 >At2g10110.1 68415.m01050 hypothetical protein Length = 169 Score = 27.9 bits (59), Expect = 6.0 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 474 HSSTWSSLVVYIHST 430 HS+TWSS + IHST Sbjct: 24 HSTTWSSTTIIIHST 38 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,196,747 Number of Sequences: 28952 Number of extensions: 196307 Number of successful extensions: 343 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 343 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1314848736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -