BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_L13 (552 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4F11.04c |||mannosyltransferase complex subunit |Schizosacch... 26 4.2 SPAC869.09 |||conserved fungal protein|Schizosaccharomyces pombe... 25 5.6 >SPCC4F11.04c |||mannosyltransferase complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 345 Score = 25.8 bits (54), Expect = 4.2 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 231 HIRCILCRTYPFSTIKLHNVHKKSNYNNNKTTI 133 HIR +L R Y FS ++ S+++NN I Sbjct: 256 HIRVLLERDYKFSNDSYFTFYEGSSWHNNDAGI 288 >SPAC869.09 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 116 Score = 25.4 bits (53), Expect = 5.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 505 YSPARHNPVVGXSRRRHQQDL 443 Y A HNP V RRH ++L Sbjct: 87 YKAAMHNPKVSQKGRRHAKEL 107 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,002,871 Number of Sequences: 5004 Number of extensions: 35843 Number of successful extensions: 78 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 229961028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -