BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_L13 (552 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0178 + 6195402-6199158,6199438-6200003 27 10.0 >03_02_0178 + 6195402-6199158,6199438-6200003 Length = 1440 Score = 27.1 bits (57), Expect = 10.0 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = -1 Query: 486 IQLSGXLEDVTSRTSVSASERTQIHAARRLKPSSSYILIELGFSFTI 346 + LSG L++ + SV SE + ++ PSSS+ GF+ ++ Sbjct: 781 LSLSGCLQNPEFKCSVPRSESLDLATCSQMLPSSSFRTNSEGFTGSV 827 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,515,974 Number of Sequences: 37544 Number of extensions: 215149 Number of successful extensions: 392 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 392 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1245816180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -