BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fe100P01_F_L13
(552 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
03_02_0178 + 6195402-6199158,6199438-6200003 27 10.0
>03_02_0178 + 6195402-6199158,6199438-6200003
Length = 1440
Score = 27.1 bits (57), Expect = 10.0
Identities = 14/47 (29%), Positives = 25/47 (53%)
Frame = -1
Query: 486 IQLSGXLEDVTSRTSVSASERTQIHAARRLKPSSSYILIELGFSFTI 346
+ LSG L++ + SV SE + ++ PSSS+ GF+ ++
Sbjct: 781 LSLSGCLQNPEFKCSVPRSESLDLATCSQMLPSSSFRTNSEGFTGSV 827
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,515,974
Number of Sequences: 37544
Number of extensions: 215149
Number of successful extensions: 392
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 388
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 392
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1245816180
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -