Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P01_F_L13
         (552 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g36200.1 68418.m04364 F-box family protein contains Pfam PF00...    27   8.3  

>At5g36200.1 68418.m04364 F-box family protein contains Pfam
           PF00646: F-box domain; contains TIGRFAM TIGR01640: F-box
           protein interaction domain; similar to unknown protein
           (pir||T00841)
          Length = 471

 Score = 27.1 bits (57), Expect = 8.3
 Identities = 19/69 (27%), Positives = 33/69 (47%)
 Frame = -1

Query: 339 CKHVNTNETNDHKINTDIN*KEKL*NEQNFLMINKRHIRCILCRTYPFSTIKLHNVHKKS 160
           CK+ NT  +NDH     +  K     E   L++     +  L       ++ LH +HK++
Sbjct: 30  CKNWNTL-SNDHSFTRKLFGKTITTKENECLVVMMMDSKVYLM------SVNLHRIHKEN 82

Query: 159 NYNNNKTTI 133
           + NN K++I
Sbjct: 83  DDNNIKSSI 91


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,289,104
Number of Sequences: 28952
Number of extensions: 181964
Number of successful extensions: 338
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 335
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 338
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1043173136
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)