BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_L05 (640 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1683.07 |mal1||alpha-glucosidase Mal1 |Schizosaccharomyces p... 29 0.75 SPBC651.03c |gyp10||GTPase activating protein Gyp10|Schizosaccha... 27 2.3 SPAC1399.03 |fur4||uracil permease|Schizosaccharomyces pombe|chr... 25 7.0 >SPBC1683.07 |mal1||alpha-glucosidase Mal1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 579 Score = 28.7 bits (61), Expect = 0.75 Identities = 29/94 (30%), Positives = 40/94 (42%), Gaps = 5/94 (5%) Frame = +2 Query: 260 MDLVSLETSDENEWVK-ARIVQDXIK---YIWTSGRLCDFKGCNRPDLLPNEINGWFWTA 427 MDLV TSD++EW K +R + K Y W R + KG P PN +F T+ Sbjct: 105 MDLVLNHTSDQHEWFKESRSSKTNPKRDWYFWKPARYNE-KGERLP---PNNWRSYFDTS 160 Query: 428 ELQKLAPTTNRQQNDWSEG-GGIGXPQPDXRELI 526 + T + WS G + P RE + Sbjct: 161 AWEWDEATQEYYLHLWSVGQPDLNWETPKVREAV 194 >SPBC651.03c |gyp10||GTPase activating protein Gyp10|Schizosaccharomyces pombe|chr 2|||Manual Length = 373 Score = 27.1 bits (57), Expect = 2.3 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 Query: 354 RPDVQMYFXLSWTIRALTHSFSSL 283 + D+Q YF LSW I H S + Sbjct: 183 KADIQCYFALSWLITWFAHDVSDI 206 >SPAC1399.03 |fur4||uracil permease|Schizosaccharomyces pombe|chr 1|||Manual Length = 581 Score = 25.4 bits (53), Expect = 7.0 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 Query: 621 GLRWWQATSCQWTXSL 574 GL WW+A C W L Sbjct: 85 GLNWWEAWICVWVGYL 100 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,390,819 Number of Sequences: 5004 Number of extensions: 46519 Number of successful extensions: 116 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 116 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 285732116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -