Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P01_F_L03
         (645 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    23   3.3  
AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    22   5.8  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    21   7.7  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    21   7.7  

>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 10/30 (33%), Positives = 16/30 (53%)
 Frame = +3

Query: 528 GSDLGKSATTLNFSSKATVASTSNKESWAI 617
           G  LG+ A   N    AT+ + ++ + WAI
Sbjct: 162 GKVLGELAILYNCKRTATITAATDCQLWAI 191


>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = +3

Query: 180 PKWRWEFWRPYT 215
           P WR++ W P+T
Sbjct: 551 PVWRFQPWGPFT 562



 Score = 21.4 bits (43), Expect = 7.7
 Identities = 12/36 (33%), Positives = 19/36 (52%)
 Frame = +2

Query: 266 YGAQALGNIINEVFXKKEVEQKRFLPSIKNYKVLGE 373
           Y A  L  I+NE+F + +   +RF       K+LG+
Sbjct: 289 YSASELVKILNELFARFDQLSERF--EQLRIKILGD 322


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
           AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +2

Query: 521 ITWLRPGEISDNP 559
           +TWL+ G+I  NP
Sbjct: 839 VTWLKGGKIELNP 851


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +2

Query: 521 ITWLRPGEISDNP 559
           +TWL+ G+I  NP
Sbjct: 835 VTWLKGGKIELNP 847


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 177,630
Number of Sequences: 438
Number of extensions: 3892
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19438227
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)