BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_L01 (535 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146733-1|AAO12093.1| 131|Anopheles gambiae odorant-binding pr... 23 8.5 AJ697724-1|CAG26917.1| 131|Anopheles gambiae putative odorant-b... 23 8.5 >AY146733-1|AAO12093.1| 131|Anopheles gambiae odorant-binding protein AgamOBP23 protein. Length = 131 Score = 22.6 bits (46), Expect = 8.5 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -3 Query: 101 FCYLRMFLLKARYNQYELLETETSSCFTI*CV 6 FC FLL A + + L + + S F + C+ Sbjct: 5 FCVASFFLLVASVHAFTLRQQKMVSIFALECM 36 >AJ697724-1|CAG26917.1| 131|Anopheles gambiae putative odorant-binding protein OBPjj14 protein. Length = 131 Score = 22.6 bits (46), Expect = 8.5 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -3 Query: 101 FCYLRMFLLKARYNQYELLETETSSCFTI*CV 6 FC FLL A + + L + + S F + C+ Sbjct: 5 FCVASFFLLVASVHAFTLRQQKMVSIFALECM 36 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 409,755 Number of Sequences: 2352 Number of extensions: 7601 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49474503 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -