BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_K22 (629 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 25 2.6 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 25 2.6 AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltr... 23 8.0 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 24.6 bits (51), Expect = 2.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 400 NPDVXSDPTLPXTKDHMCPKC 462 NPD + PT P K H+CP C Sbjct: 407 NPDYVA-PT-PKAKTHICPTC 425 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 24.6 bits (51), Expect = 2.6 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +1 Query: 235 IQFCQECNNMLYPREDKNNKV-LLYACRNCDYKQL 336 I+ +CN+++YPR V + CR+ Y QL Sbjct: 371 IETTSKCNDIIYPRLPSLAGVNMAMVCRSNSYPQL 405 >AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltransferase protein. Length = 426 Score = 23.0 bits (47), Expect = 8.0 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 278 KIKITKFCCTRAEIVIINNLRIQIA 352 K+K + C +A +VI N +IQI+ Sbjct: 2 KVKKLQHCLHKACVVIYNTXQIQIS 26 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 557,310 Number of Sequences: 2352 Number of extensions: 10212 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61468785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -