BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_K20 (650 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1014 - 23586552-23587224,23587402-23587463,23587735-235879... 28 7.4 03_03_0111 + 14527548-14528543,14529158-14529337,14529428-14529805 28 7.4 >08_02_1014 - 23586552-23587224,23587402-23587463,23587735-23587950, 23588125-23588209,23589232-23589389,23589505-23589625, 23590081-23590243,23590330-23590415,23590660-23590742, 23590816-23591677,23593266-23593693 Length = 978 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 Query: 646 LCFIDPFFXCEQCSTKCYCSF 584 +CF F C+QC YCSF Sbjct: 125 VCFRPTTFRCKQCKAVKYCSF 145 >03_03_0111 + 14527548-14528543,14529158-14529337,14529428-14529805 Length = 517 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +2 Query: 338 STILNLIVQIYMLPSVICLSQKCK-IQIVNLNI 433 S L + Q+Y + SV+CL +CK ++ + LNI Sbjct: 355 SLSLQVFAQVYDIASVLCLLTRCKFLKHLELNI 387 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,576,406 Number of Sequences: 37544 Number of extensions: 174577 Number of successful extensions: 305 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 301 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 305 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -