BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_K20 (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 23 1.9 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 5.9 DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. 22 5.9 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 5.9 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 22 5.9 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 23.4 bits (48), Expect = 1.9 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 5/54 (9%) Frame = +1 Query: 226 MIFTNN*KSFCNPILQLXKKCV-----KKIRKSTTVIEEMQIQHYFKFNCANIH 372 MIFTNN +F N +L K V I S T + + + +Y N I+ Sbjct: 1 MIFTNNIAAFQNVVLVKKVKIVLLIFYGSIMFSMTQVNKEECDYYQNLNLGEIY 54 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 335 ICISSITVVDFLIFFTHFLXNCNIGL 258 + I S+TV + +F HF N G+ Sbjct: 448 VSIESVTVDKLITYFDHFESMLNNGV 473 >DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. Length = 135 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = -1 Query: 338 CICISSITVVDFLIFFTHFLXNCNI 264 C+C+ ++T+ +F I + C I Sbjct: 11 CVCVGALTLEEFQIGLRAVVPICRI 35 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 335 ICISSITVVDFLIFFTHFLXNCNIGL 258 + I S+TV + +F HF N G+ Sbjct: 448 VSIESVTVDKLITYFDHFESMLNNGV 473 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 335 ICISSITVVDFLIFFTHFLXNCNIGL 258 + I S+TV + +F HF N G+ Sbjct: 74 VSIESVTVDKLITYFDHFESMLNNGV 99 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,512 Number of Sequences: 438 Number of extensions: 2458 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -