BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_K19 (583 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 23 1.9 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 23 1.9 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 3.3 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 4.4 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 21 5.8 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 86 LNLTQPLLNYPTNYXDTVPNTLKL 157 L+ T+P+L YP NY ++ +L L Sbjct: 29 LSDTRPMLPYPQNYINSYLFSLSL 52 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 23.0 bits (47), Expect = 1.9 Identities = 9/35 (25%), Positives = 18/35 (51%) Frame = +2 Query: 125 YXDTVPNTLKLHATFYFTLLLCPSLMTYVRYYSNI 229 + + + ++L+ FY+T LC + + Y NI Sbjct: 142 FREYLAEAVQLYFQFYYTYFLCVIVCIFRGKYRNI 176 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.2 bits (45), Expect = 3.3 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 155 LHATFYFTLLLCPSLMTYVRYYSNIVVSTH 244 L T+YF L Y YY+ I+ + H Sbjct: 97 LLCTYYFYYAFIILLCVYYFYYAFIIFTVH 126 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 391 ATSSSTNEKGEQTKSKHTVYRRSEE 465 +TSSST+ +QT R SE+ Sbjct: 387 STSSSTHTSSQQTSDSFLSKRNSEK 411 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 145 HAETTRYFLLYAIIVSLINDLCTI 216 +A+ YFL+YA++ L+ T+ Sbjct: 152 YAQFIVYFLIYAVLEMLLQKYKTV 175 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,530 Number of Sequences: 336 Number of extensions: 1892 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14517299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -