BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_K19 (583 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC050525-1|AAH50525.1| 785|Homo sapiens ubiquitin specific pept... 29 9.1 AL117503-1|CAB55967.1| 217|Homo sapiens hypothetical protein pr... 29 9.1 AF117386-1|AAD11441.1| 785|Homo sapiens ubiquitin-specific prot... 29 9.1 AB208893-1|BAD92130.1| 586|Homo sapiens ubiquitin specific prot... 29 9.1 AB018326-1|BAA34503.2| 899|Homo sapiens KIAA0783 protein protein. 29 9.1 AB014458-1|BAA34703.1| 785|Homo sapiens ubiquitin specific prot... 29 9.1 >BC050525-1|AAH50525.1| 785|Homo sapiens ubiquitin specific peptidase 1 protein. Length = 785 Score = 29.5 bits (63), Expect = 9.1 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +2 Query: 407 PTKRVNKPNPNIQSTGGPKKSKIDVIEHNDDSNDEEKTSQRTTLSVQQQXENATATYE 580 P+K +NK N G +KSK D +N SN ++ S + + + T T+E Sbjct: 654 PSKVLNKKNVEAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRNSETSDTTGTHE 711 >AL117503-1|CAB55967.1| 217|Homo sapiens hypothetical protein protein. Length = 217 Score = 29.5 bits (63), Expect = 9.1 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +2 Query: 407 PTKRVNKPNPNIQSTGGPKKSKIDVIEHNDDSNDEEKTSQRTTLSVQQQXENATATYE 580 P+K +NK N G +KSK D +N SN ++ S + + + T T+E Sbjct: 86 PSKVLNKKNVEAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRNSETSDTTGTHE 143 >AF117386-1|AAD11441.1| 785|Homo sapiens ubiquitin-specific protease protein. Length = 785 Score = 29.5 bits (63), Expect = 9.1 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +2 Query: 407 PTKRVNKPNPNIQSTGGPKKSKIDVIEHNDDSNDEEKTSQRTTLSVQQQXENATATYE 580 P+K +NK N G +KSK D +N SN ++ S + + + T T+E Sbjct: 654 PSKVLNKKNVEAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRNSETSDTTGTHE 711 >AB208893-1|BAD92130.1| 586|Homo sapiens ubiquitin specific protease 1 variant protein. Length = 586 Score = 29.5 bits (63), Expect = 9.1 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +2 Query: 407 PTKRVNKPNPNIQSTGGPKKSKIDVIEHNDDSNDEEKTSQRTTLSVQQQXENATATYE 580 P+K +NK N G +KSK D +N SN ++ S + + + T T+E Sbjct: 455 PSKVLNKKNVEAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRNSETSDTTGTHE 512 >AB018326-1|BAA34503.2| 899|Homo sapiens KIAA0783 protein protein. Length = 899 Score = 29.5 bits (63), Expect = 9.1 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 446 STGGPKKSKIDVIEHNDDSNDEEKTSQRTTLSVQQQXENA 565 S GG KK K V+ N ++DEE T+ TLS + E++ Sbjct: 275 SEGGCKKKKSKVLSRNS-ADDEELTNDSLTLSQSKSNEDS 313 >AB014458-1|BAA34703.1| 785|Homo sapiens ubiquitin specific protease protein. Length = 785 Score = 29.5 bits (63), Expect = 9.1 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +2 Query: 407 PTKRVNKPNPNIQSTGGPKKSKIDVIEHNDDSNDEEKTSQRTTLSVQQQXENATATYE 580 P+K +NK N G +KSK D +N SN ++ S + + + T T+E Sbjct: 654 PSKVLNKKNVEAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRNSETSDTTGTHE 711 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,168,524 Number of Sequences: 237096 Number of extensions: 970084 Number of successful extensions: 1722 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1722 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6042162242 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -