BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_K17 (652 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U88167-3|AAB42224.2| 363|Caenorhabditis elegans Hypothetical pr... 50 2e-06 AC006834-9|AAL11490.1| 447|Caenorhabditis elegans Hypothetical ... 32 0.31 >U88167-3|AAB42224.2| 363|Caenorhabditis elegans Hypothetical protein D2092.4 protein. Length = 363 Score = 49.6 bits (113), Expect = 2e-06 Identities = 32/113 (28%), Positives = 53/113 (46%), Gaps = 2/113 (1%) Frame = +3 Query: 285 KQNCETCXKLEQHVQSLQEDFKKHLNAMSVXTVNSHLARLYNPSKEPXLIFYRHGVALLY 464 K C TC + V+ + +D + V T + +AR + P L++YR +LY Sbjct: 104 KVPCPTCTEALSEVEEIDDDIEATGYVQVVKTNDRSVARELGINVFPSLVYYRRKNPILY 163 Query: 465 SGEADENE-IYGFFXKNQTPAVKXLTXKIFEHLTQA-ATGATTGDWFVMFYGA 617 G+ ++E + + ++ A LT FE T + + + DWFVMFY A Sbjct: 164 DGDFKDSETLLRWLRAHEEVATWDLTDDTFESRTDSHSPDEGSIDWFVMFYDA 216 >AC006834-9|AAL11490.1| 447|Caenorhabditis elegans Hypothetical protein ZK973.11 protein. Length = 447 Score = 32.3 bits (70), Expect = 0.31 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +3 Query: 588 GDWFVMFYGAACVECQRLHAV 650 G WFV FY C C+RLH V Sbjct: 44 GMWFVEFYAPWCAHCKRLHPV 64 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,654,394 Number of Sequences: 27780 Number of extensions: 194767 Number of successful extensions: 522 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 521 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -