BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_K15 (402 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11388| Best HMM Match : MFS_1 (HMM E-Value=0.0022) 27 5.7 SB_5445| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 >SB_11388| Best HMM Match : MFS_1 (HMM E-Value=0.0022) Length = 720 Score = 27.1 bits (57), Expect = 5.7 Identities = 20/60 (33%), Positives = 32/60 (53%) Frame = -1 Query: 279 IYLSVKESYLQGGHQLHVIFLT*FNVKIFKLYFVVFVFFSRINQLIPALGGYRIKVQITD 100 I LS+K+ LQ L + T + FK ++ FVF+S I + P L GY ++ I++ Sbjct: 22 IPLSLKKLELQQNGTLSKVNKT---LLFFKYFY--FVFYSAIGTVFPFLNGYIRQIGISN 76 >SB_5445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 26.6 bits (56), Expect = 7.6 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +2 Query: 131 PKAGISWLIREKKTKTTKYSLKIFTLNYVRN 223 PK G+ L R KK K + SL +TLNY N Sbjct: 147 PKTGLLEL-RGKKLKIKRDSLLNYTLNYAEN 176 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,524,758 Number of Sequences: 59808 Number of extensions: 142439 Number of successful extensions: 250 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 244 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 250 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 715479706 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -