BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_K14 (414 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC115.02c |||AFG1 family mitochondrial ATPase|Schizosaccharomy... 27 1.2 SPCC757.02c |||epimarase |Schizosaccharomyces pombe|chr 3|||Manual 27 1.5 SPAC24B11.07c |||ketopantoate reductase |Schizosaccharomyces pom... 25 4.7 SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr... 25 6.1 SPBC56F2.05c |||transcription factor |Schizosaccharomyces pombe|... 25 6.1 SPBC1271.13 |mrpl8||mitochondrial ribosomal protein subunit L8|S... 25 6.1 SPAC4F8.07c |hxk2||hexokinase 2 |Schizosaccharomyces pombe|chr 1... 24 8.1 >SPBC115.02c |||AFG1 family mitochondrial ATPase|Schizosaccharomyces pombe|chr 2|||Manual Length = 454 Score = 27.1 bits (57), Expect = 1.2 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +1 Query: 139 VIKRNIIVALALSGVAGFTFKQLIGNER 222 V R IIV A VA FTF+QL G + Sbjct: 311 VFGRKIIVPKASGNVAWFTFEQLCGEPK 338 >SPCC757.02c |||epimarase |Schizosaccharomyces pombe|chr 3|||Manual Length = 405 Score = 26.6 bits (56), Expect = 1.5 Identities = 11/25 (44%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +1 Query: 220 RKRKYAEFYRTYDAEKE-FEEMRKK 291 RK Y ++Y T+D KE F+E++K+ Sbjct: 375 RKLGYTDYYDTFDGFKETFDELKKQ 399 >SPAC24B11.07c |||ketopantoate reductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 561 Score = 25.0 bits (52), Expect = 4.7 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -1 Query: 210 NELLEGKTSDARESQSNNNVTFDDGVEET 124 NE+L S++ ++S N T D G ET Sbjct: 488 NEVLSRPNSNSNSAESRNGETDDSGESET 516 >SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr 2|||Manual Length = 1471 Score = 24.6 bits (51), Expect = 6.1 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 235 AEFYRTYDAEKEFEEMRKKGLFQSC 309 A+F+R Y+A K F ++K + C Sbjct: 856 AKFWRAYNARKTFRGLKKSVIALQC 880 >SPBC56F2.05c |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 397 Score = 24.6 bits (51), Expect = 6.1 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 198 EGKTSDARESQSNNNVTFDDGVEETSHLRLARCR 97 +GK + S ++VTF D S R +RC+ Sbjct: 313 KGKEASEVNPNSTSSVTFSDFAAAISRSRCSRCK 346 >SPBC1271.13 |mrpl8||mitochondrial ribosomal protein subunit L8|Schizosaccharomyces pombe|chr 2|||Manual Length = 207 Score = 24.6 bits (51), Expect = 6.1 Identities = 13/55 (23%), Positives = 26/55 (47%) Frame = +1 Query: 130 LNAVIKRNIIVALALSGVAGFTFKQLIGNERKRKYAEFYRTYDAEKEFEEMRKKG 294 L + ++NI L F QL+ E++ ++A ++ EK ++ K+G Sbjct: 144 LTPITRKNIHKVLLFRKNGKAEFDQLVQKEKESEHARLKEDHEDEKTVKKDWKRG 198 >SPAC4F8.07c |hxk2||hexokinase 2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 455 Score = 24.2 bits (50), Expect = 8.1 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = +1 Query: 256 DAEKEFEEMRKKGL 297 +A KEF+E+R+KGL Sbjct: 25 EAVKEFDELRQKGL 38 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,347,636 Number of Sequences: 5004 Number of extensions: 22236 Number of successful extensions: 73 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 144287194 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -