BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_K14 (414 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32430.1 68417.m04616 pentatricopeptide (PPR) repeat-containi... 30 0.71 At2g36730.1 68415.m04506 pentatricopeptide (PPR) repeat-containi... 29 1.2 At5g16860.1 68418.m01975 pentatricopeptide (PPR) repeat-containi... 28 2.9 At3g02850.1 68416.m00277 stelar K+ outward rectifier (SKOR) / po... 28 2.9 At4g30700.1 68417.m04351 pentatricopeptide (PPR) repeat-containi... 27 3.8 At3g26580.1 68416.m03318 expressed protein 27 5.0 At3g12280.1 68416.m01533 retinoblastoma-related protein (RBR1) n... 27 5.0 At2g14570.1 68415.m01632 SWIM zinc finger family protein 27 5.0 At4g20290.1 68417.m02963 expressed protein 27 6.6 At4g35880.1 68417.m05095 aspartyl protease family protein contai... 26 8.7 At4g31070.1 68417.m04411 pentatricopeptide (PPR) repeat-containi... 26 8.7 >At4g32430.1 68417.m04616 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 763 Score = 29.9 bits (64), Expect = 0.71 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 4/57 (7%) Frame = +1 Query: 124 GLLNAV-IKRNIIVALALSGVA---GFTFKQLIGNERKRKYAEFYRTYDAEKEFEEM 282 GL+NAV I L + G+ GF + +GN YA+F DA+K FE++ Sbjct: 377 GLINAVKCNEQIKEGLKIHGLCIKTGFVSEPSVGNSFITLYAKFEALEDAKKAFEDI 433 >At2g36730.1 68415.m04506 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 501 Score = 29.1 bits (62), Expect = 1.2 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 187 GFTFKQLIGNERKRKYAEFYRTYDAEKEFEEMRKKGL 297 GF F +GN Y +T DA K F+EM ++ + Sbjct: 143 GFDFDVYVGNNLIHLYGTCKKTSDARKVFDEMTERNV 179 >At5g16860.1 68418.m01975 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 850 Score = 27.9 bits (59), Expect = 2.9 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +1 Query: 163 ALALSGVAGFTFKQLIGNERKRKYAEFYRTYDAEKEFEEM 282 A ALS V GF +GN Y+ DA K F+EM Sbjct: 149 AHALSLVTGFISNVFVGNALVAMYSRCRSLSDARKVFDEM 188 >At3g02850.1 68416.m00277 stelar K+ outward rectifier (SKOR) / potassium channel protein identical to SKOR [Arabidopsis thaliana] gi|3810676|emb|CAA11280; member of the 1 pore, 6 transmembrane (1P/6TM) Shaker K+ channel family, PMID:11500563 Length = 828 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 216 ITNELLEGKTSDARESQSNNNVTFDDGVEE 127 I N LLEGK S+ R Q +++TF +E Sbjct: 516 ILNNLLEGKESNVRIKQLESDITFHISKQE 545 >At4g30700.1 68417.m04351 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 792 Score = 27.5 bits (58), Expect = 3.8 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 181 VAGFTFKQLIGNERKRKYAEFYRTYDAEKEFEEMRKK 291 V G + L+G+ + Y +F+R DA K F+ M +K Sbjct: 147 VDGCDSELLLGSNIVKMYFKFWRVEDARKVFDRMPEK 183 >At3g26580.1 68416.m03318 expressed protein Length = 350 Score = 27.1 bits (57), Expect = 5.0 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 208 IGNERKRKYAEFYRTYDAEKEFEEMRKK 291 + ERKR+ EF+ T + E++ EE++ K Sbjct: 113 VEKERKRRAKEFHDTKELERKAEELQYK 140 >At3g12280.1 68416.m01533 retinoblastoma-related protein (RBR1) nearly identical to retinoblastoma-related protein [Arabidopsis thaliana] GI:8777927; contains Pfam profiles: PF01858 retinoblastoma-associated protein A domain, PF01857 retinoblastoma-associated protein B domain Length = 1013 Score = 27.1 bits (57), Expect = 5.0 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 184 AGFTFKQLIGNERKRKYAEFYRTYDAEKE 270 A F L+ KR + EF+ TYDA E Sbjct: 149 ANFVHLSLLSKYYKRGFREFFLTYDANAE 177 >At2g14570.1 68415.m01632 SWIM zinc finger family protein Length = 435 Score = 27.1 bits (57), Expect = 5.0 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 227 ESMLNSTEPMMLKRNLRRCARRVYSNPAKYELSXC 331 + +LN+ E + K R CAR +Y N K LS C Sbjct: 275 KGLLNAIERKLPKVEYRMCARHIYGNLKK--LSPC 307 >At4g20290.1 68417.m02963 expressed protein Length = 118 Score = 26.6 bits (56), Expect = 6.6 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 199 KQLIGNERKRKYAEFYRTYDAEKEFEEMRKKG 294 K+ G E+KR+ + D E+E EE R+KG Sbjct: 13 KERGGEEKKRRRSALNSEEDEEEEEEEGRRKG 44 >At4g35880.1 68417.m05095 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 524 Score = 26.2 bits (55), Expect = 8.7 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = -1 Query: 240 FSILSLALITNELLEGKTSDARESQSNNNVTFDDGVEETSHLRLARCRYCT 88 F + ++ + L+ G+ ES+S +++TF DG + L Y T Sbjct: 60 FEYFNALVLRDWLIRGRRLSESESESESSLTFSDGNSTSRISSLGFLHYTT 110 >At4g31070.1 68417.m04411 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 613 Score = 26.2 bits (55), Expect = 8.7 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +1 Query: 184 AGFTFKQLIGNERKRKYAEFYRTYDAEKEFEEMRKKGLFQSC 309 AG ++ N YA+F R Y K F+EM + C Sbjct: 76 AGADCDTVVSNSLISMYAKFSRKYAVRKVFDEMLHRDTVSYC 117 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,863,638 Number of Sequences: 28952 Number of extensions: 113481 Number of successful extensions: 388 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 385 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 388 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 625471056 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -