BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_K13 (608 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit ... 25 6.5 SPAC4A8.05c |myp2|myo3|myosin II heavy chain |Schizosaccharomyce... 25 8.7 >SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit Bgs4|Schizosaccharomyces pombe|chr 3|||Manual Length = 1955 Score = 25.4 bits (53), Expect = 6.5 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 357 PSGWERLRL*RAWVQACLCSLFRLLWSSF 271 P G +L +W++ C+ S+F + W SF Sbjct: 1404 PRGCYQLGPVLSWLKRCVISIFIVFWISF 1432 >SPAC4A8.05c |myp2|myo3|myosin II heavy chain |Schizosaccharomyces pombe|chr 1|||Manual Length = 2104 Score = 25.0 bits (52), Expect = 8.7 Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 5/60 (8%) Frame = +1 Query: 361 LRKLKM*SLKTSKVXNNRRVRD--LHARSIVMLSVRLRVVVK---IGRRTVPXKTRKELR 525 +++++M +LKT K NN R + LH + V+ + + +K + +T P T K++R Sbjct: 1910 IKQIEMFALKTQKDSNNHREENLQLHRQLGVLQKEKKDLELKLFDLDLKTYPISTSKDVR 1969 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,928,601 Number of Sequences: 5004 Number of extensions: 31731 Number of successful extensions: 60 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 268287866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -