BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_K13 (608 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0798 + 7314885-7314953,7315324-7315387,7315489-7315677,731... 29 2.2 >12_01_0798 + 7314885-7314953,7315324-7315387,7315489-7315677, 7316430-7316625,7316727-7316953,7317177-7318134, 7320104-7321307,7321517-7321876,7321965-7323195, 7323334-7323599,7323738-7326335 Length = 2453 Score = 29.5 bits (63), Expect = 2.2 Identities = 22/62 (35%), Positives = 36/62 (58%), Gaps = 2/62 (3%) Frame = -1 Query: 212 QEKSVSVHYSHTVGILHCDPLDDLITQYLDVI--GLLSAQLVRRHFVLFY*FHLIWRTDS 39 +E ++H S TV L D + L++ Y+DV+ GL+S Q V +H+VL L RT++ Sbjct: 1719 EEVCKNIHAS-TVRAL-ADMVQALVSMYVDVLAKGLISRQGVYKHYVLGLLASLEGRTEA 1776 Query: 38 NN 33 + Sbjct: 1777 RS 1778 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,271,818 Number of Sequences: 37544 Number of extensions: 227459 Number of successful extensions: 477 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1454766756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -