SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P01_F_K13
         (608 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_01_0798 + 7314885-7314953,7315324-7315387,7315489-7315677,731...    29   2.2  

>12_01_0798 + 7314885-7314953,7315324-7315387,7315489-7315677,
            7316430-7316625,7316727-7316953,7317177-7318134,
            7320104-7321307,7321517-7321876,7321965-7323195,
            7323334-7323599,7323738-7326335
          Length = 2453

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 22/62 (35%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -1

Query: 212  QEKSVSVHYSHTVGILHCDPLDDLITQYLDVI--GLLSAQLVRRHFVLFY*FHLIWRTDS 39
            +E   ++H S TV  L  D +  L++ Y+DV+  GL+S Q V +H+VL     L  RT++
Sbjct: 1719 EEVCKNIHAS-TVRAL-ADMVQALVSMYVDVLAKGLISRQGVYKHYVLGLLASLEGRTEA 1776

Query: 38   NN 33
             +
Sbjct: 1777 RS 1778


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,271,818
Number of Sequences: 37544
Number of extensions: 227459
Number of successful extensions: 477
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 467
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 477
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1454766756
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -