BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_K07 (645 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 24 1.4 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 24 1.4 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 22 4.4 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 5.8 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 5.8 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 23.8 bits (49), Expect = 1.4 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 459 LPVNVPLWLAIMLKQKQKCHVIPPDWMDVEXLENIKQEEK 578 LPV LW I L Q H+ ++ E +EN++ EK Sbjct: 52 LPVCNGLWRWIRLTYGQTNHISLTLDLEYELVENLQANEK 91 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 23.8 bits (49), Expect = 1.4 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 459 LPVNVPLWLAIMLKQKQKCHVIPPDWMDVEXLENIKQEEK 578 LPV LW I L Q H+ ++ E +EN++ EK Sbjct: 90 LPVCNGLWRWIRLTYGQTNHISLTLDLEYELVENLQANEK 129 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -3 Query: 421 YILSWVKFGVILII 380 Y+LSW +GV+ +I Sbjct: 283 YVLSWTPYGVMSMI 296 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +1 Query: 400 TLPMIKYT*YAVNLVRFVLVYL*TYHSGWLS 492 T P I + N+++FV V TY W S Sbjct: 498 TTPAICVGVFTFNIIKFVPVKYLTYEYPWWS 528 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +1 Query: 400 TLPMIKYT*YAVNLVRFVLVYL*TYHSGWLS 492 T P I + N+++FV V TY W S Sbjct: 551 TTPAICVGVFTFNIIKFVPVKYLTYEYPWWS 581 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,346 Number of Sequences: 438 Number of extensions: 2985 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19438227 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -