BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_K04 (651 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 25 2.1 AY146729-1|AAO12089.1| 156|Anopheles gambiae odorant-binding pr... 25 2.1 AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. 24 4.8 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 24 4.8 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 25.0 bits (52), Expect = 2.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 284 HPDAVPKISCLVAEVLPISAM 222 HP VPK C +++PIS + Sbjct: 393 HPTKVPKPCCAPTKLIPISVL 413 >AY146729-1|AAO12089.1| 156|Anopheles gambiae odorant-binding protein AgamOBP5 protein. Length = 156 Score = 25.0 bits (52), Expect = 2.1 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 318 SSSCWTWRW 344 S SCW WRW Sbjct: 4 SRSCWWWRW 12 >AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. Length = 441 Score = 23.8 bits (49), Expect = 4.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 290 VIHPDAVPKISCLVAEVLPISAM 222 ++HP VPK C ++ PIS + Sbjct: 395 LMHPTRVPKPCCAPTKLNPISVL 417 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 23.8 bits (49), Expect = 4.8 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = +1 Query: 127 NXKSVMAKPKNEDASEEA---KKIVDDAKNFIERAIADIGKTSATK 255 N K+++ + E+ +E KK+V+D K I+ I D+ + K Sbjct: 982 NQKAMVLLEREEEQYKEVMRRKKVVEDDKKKIQAIITDLDEEKKKK 1027 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 494,059 Number of Sequences: 2352 Number of extensions: 8678 Number of successful extensions: 19 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -