BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_K01 (361 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 2.6 AJ304412-1|CAC39105.1| 196|Anopheles gambiae dynamin protein. 23 4.6 AF080563-1|AAC31943.1| 310|Anopheles gambiae Ultrabithorax home... 23 4.6 AF080562-1|AAC31942.1| 327|Anopheles gambiae Ultrabithorax home... 23 4.6 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 22 8.0 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.4 bits (48), Expect = 2.6 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -3 Query: 188 RSC*RLVFLDVKHRKPSACAPTICWS*TCEC 96 R C RL + ++ C P C+ T EC Sbjct: 477 REC-RLGYFNLDAENKFGCTPCFCYGHTLEC 506 >AJ304412-1|CAC39105.1| 196|Anopheles gambiae dynamin protein. Length = 196 Score = 22.6 bits (46), Expect = 4.6 Identities = 11/51 (21%), Positives = 22/51 (43%) Frame = +2 Query: 98 TRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVXFVFG 250 T+ F+ LLA D + + + + RE++ +MY + + G Sbjct: 132 TKDFINGELLAHLYATGDQASMMEESADEAQKREEMLRMYHACKEALRIIG 182 >AF080563-1|AAC31943.1| 310|Anopheles gambiae Ultrabithorax homeotic protein IVa protein. Length = 310 Score = 22.6 bits (46), Expect = 4.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 299 YDTLDLAKKFEPKHRLXR 352 Y TL+L K+F H L R Sbjct: 229 YQTLELEKEFHTNHYLTR 246 >AF080562-1|AAC31942.1| 327|Anopheles gambiae Ultrabithorax homeotic protein IIa protein. Length = 327 Score = 22.6 bits (46), Expect = 4.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 299 YDTLDLAKKFEPKHRLXR 352 Y TL+L K+F H L R Sbjct: 246 YQTLELEKEFHTNHYLTR 263 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 21.8 bits (44), Expect = 8.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 152 HRKPSACAPTICWS*T 105 HR P+ CAP + S T Sbjct: 1376 HRSPNGCAPNLLSSTT 1391 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 374,040 Number of Sequences: 2352 Number of extensions: 6883 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 26654730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -