BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_J22 (569 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 3.7 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 3.7 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 8.6 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.2 bits (45), Expect = 3.7 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +2 Query: 224 LQQGLEGRLRVRAATAQRLRQESPXQRSETRTARPRR 334 L+QG++ L + A R SP + +E+ P R Sbjct: 357 LKQGIQFHLYINTAPCGDARIFSPHEENESVDKHPNR 393 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 113 HHRSLGQSDAGEENYELGGHDVL 45 HH+ + AG + L GH VL Sbjct: 920 HHQIQVSTSAGLQTIRLSGHSVL 942 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 250 EPSFQALLKSCASFDLVSELN 188 EP + + ASFD +SE+N Sbjct: 59 EPLLVGMDLTIASFDAISEVN 79 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.315 0.125 0.355 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,966 Number of Sequences: 438 Number of extensions: 1831 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -