BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_J19 (624 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF039044-4|AAG24122.3| 328|Caenorhabditis elegans Serpentine re... 29 2.0 Z81587-2|CAB04702.2| 339|Caenorhabditis elegans Hypothetical pr... 28 4.7 Z54218-4|CAA90958.1| 1367|Caenorhabditis elegans Hypothetical pr... 28 6.2 Z49910-9|CAA90125.1| 1367|Caenorhabditis elegans Hypothetical pr... 28 6.2 Z93388-12|CAB07661.2| 294|Caenorhabditis elegans Hypothetical p... 27 8.2 AF100675-1|AAC69003.2| 370|Caenorhabditis elegans Hypothetical ... 27 8.2 >AF039044-4|AAG24122.3| 328|Caenorhabditis elegans Serpentine receptor, class t protein17 protein. Length = 328 Score = 29.5 bits (63), Expect = 2.0 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +1 Query: 373 DRNLNTSFFDPAGGGDPILYQHLF*FFGHPEVYILILPGFGIISHI 510 + N ++ F DP G DP LY++ F + V I + +G IS++ Sbjct: 187 NENYSSWFTDPGLGHDPALYKNSLIAFNNFAVAICTIVFYGYISYV 232 >Z81587-2|CAB04702.2| 339|Caenorhabditis elegans Hypothetical protein T06G6.2 protein. Length = 339 Score = 28.3 bits (60), Expect = 4.7 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +3 Query: 504 SYYFTRKRKKRNFWLFRNNLCYTSNWVIXIYCLSSSYIH 620 SYYF R R W +NN+ S +I + CL +S IH Sbjct: 42 SYYFARLAI-RTLW--KNNIFSNSTRLILLVCLLNSIIH 77 >Z54218-4|CAA90958.1| 1367|Caenorhabditis elegans Hypothetical protein F44G4.8 protein. Length = 1367 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 469 KLQDVQKIKINVDIKLGLLLQQDQKMMYLSFD 374 KLQD+QK+K +VD+ + L +D+ + + D Sbjct: 822 KLQDIQKVKQDVDVSIFEELGEDETCLEVRAD 853 >Z49910-9|CAA90125.1| 1367|Caenorhabditis elegans Hypothetical protein F44G4.8 protein. Length = 1367 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 469 KLQDVQKIKINVDIKLGLLLQQDQKMMYLSFD 374 KLQD+QK+K +VD+ + L +D+ + + D Sbjct: 822 KLQDIQKVKQDVDVSIFEELGEDETCLEVRAD 853 >Z93388-12|CAB07661.2| 294|Caenorhabditis elegans Hypothetical protein T10C6.4 protein. Length = 294 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +3 Query: 423 NFISTFILIFWTS*SLYFNFTRIWYNFSYYF 515 N++ T+I+I WT + +++ +YN S+ F Sbjct: 111 NYVLTYIIINWTLPPVIYSYFFFFYNCSFPF 141 >AF100675-1|AAC69003.2| 370|Caenorhabditis elegans Hypothetical protein Y55H10A.2 protein. Length = 370 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = +3 Query: 450 FWTS*SLYFNFTRIWYNFSYYFTRKRKKRNFWLFRNNLCYTSNWVIXI 593 F+++ ++ NF Y R R+ RN LF+ C W I + Sbjct: 251 FYSTPLYTMTLSKTMVNFMIYMIRYRELRNIILFKIIACLPQKWSIPL 298 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,440,932 Number of Sequences: 27780 Number of extensions: 224324 Number of successful extensions: 461 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 461 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1363963182 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -