BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_J17 (551 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 23 2.3 DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory pro... 22 3.1 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 9.5 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 22.6 bits (46), Expect = 2.3 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +1 Query: 298 GQKSLFHNPHVNALPXGYEXDH 363 G + L H+PH+N Y +H Sbjct: 35 GLQGLHHSPHLNHAMHPYHANH 56 >DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory protein 20 protein. Length = 124 Score = 22.2 bits (45), Expect = 3.1 Identities = 7/26 (26%), Positives = 17/26 (65%) Frame = -3 Query: 435 LTFNNLKYMNVLQTNFLKQNYCNLVV 358 + ++N+ +LQ++ L +NY N ++ Sbjct: 25 IKYDNVNLKEILQSDRLTENYVNCLL 50 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 20.6 bits (41), Expect = 9.5 Identities = 11/42 (26%), Positives = 18/42 (42%) Frame = -2 Query: 322 GCGKGTSVHHPMGNALYECACIHKVQMADVHGVPLGELSRHL 197 G G G+ + P G + + ++ D L ELS H+ Sbjct: 526 GGGSGSGNNQPPGGPSSHVSAVLTCKVCDQAFSSLKELSNHM 567 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,681 Number of Sequences: 336 Number of extensions: 2497 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13621010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -