BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_J17 (551 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1739.09c |cox13||cytochrome c oxidase subunit VIa|Schizosacc... 57 2e-09 >SPCC1739.09c |cox13||cytochrome c oxidase subunit VIa|Schizosaccharomyces pombe|chr 3|||Manual Length = 130 Score = 57.2 bits (132), Expect = 2e-09 Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 4/69 (5%) Frame = +1 Query: 145 WKRMSFFVAFPAIALGMLNAYLAH--QEEH--HERPPFVPYEYMRIRTKRFPWGDGQKSL 312 WK++++++ PA+ L NAY + +EH H Y + +R K++PWGDG K+L Sbjct: 57 WKKVTYYIGGPALILASANAYYIYCKHQEHAKHVEDTDPGYSFENLRFKKYPWGDGSKTL 116 Query: 313 FHNPHVNAL 339 F N VN L Sbjct: 117 FWNDKVNHL 125 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,077,243 Number of Sequences: 5004 Number of extensions: 38810 Number of successful extensions: 80 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 79 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 229961028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -