BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_J11 (652 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21895| Best HMM Match : E1-E2_ATPase (HMM E-Value=0.008) 29 3.3 SB_37547| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_21895| Best HMM Match : E1-E2_ATPase (HMM E-Value=0.008) Length = 659 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -3 Query: 200 SLVDHQYLFQALSVCLEWTNSL*GEDQYFYFAL 102 S +D Y+FQ SVCL W N D Y+Y+A+ Sbjct: 109 SALDPFYIFQVASVCL-WLN-----DNYYYYAV 135 >SB_37547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1186 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +2 Query: 110 NKNIGPLLTMSSSTPNKHLKLEINIGDQLTTISCGHVVAE 229 N N+ PL+T+ + K LK +++ L +++C V+A+ Sbjct: 474 NYNVYPLVTLENLEKKKMLKHALDVEFLLLSLACAKVMAQ 513 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,458,078 Number of Sequences: 59808 Number of extensions: 316007 Number of successful extensions: 573 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 573 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -