BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_J10 (653 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC409.18 |||phosphatidic acid phosphatase |Schizosaccharomyces... 31 0.15 SPAPB1A10.02 |||chromosome segregation protein |Schizosaccharomy... 29 0.44 SPCC777.03c |||nifs homolog|Schizosaccharomyces pombe|chr 3|||Ma... 27 3.1 SPBC19G7.16 |iws1||transcription elongation factor complex subun... 26 4.1 SPBP4H10.15 |||aconitate hydratase|Schizosaccharomyces pombe|chr... 25 7.2 >SPBC409.18 |||phosphatidic acid phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 279 Score = 31.1 bits (67), Expect = 0.15 Identities = 32/136 (23%), Positives = 53/136 (38%), Gaps = 2/136 (1%) Frame = +1 Query: 241 VEMQAKH-SVLWHLLIDLPIVLLVAAVCICLEVGALPSRRSGFTCNDPALSFPHT-GDTF 414 +E KH + W++ D +++ ++ +V LP R F+ D +S P + Sbjct: 1 MEAVGKHVKLFWNVYSDYAVLIAISLSYFVFDVLMLPFTRQ-FSLEDITISHPFALHEQV 59 Query: 415 SISLVAAITVIVPFFVLWAVQAMLYQDDEYNMXKRKMLASAKTAGLIYRDYIYGAVVNLT 594 + I V P VL+ + +L GL+Y + G V+L Sbjct: 60 PTKYLGIICVFFPALVLYGFG---------KLRNNSLLFWKSLMGLLYSTMVCGLCVSL- 109 Query: 595 ILEVVKCVVGTPRPTF 642 +K VG PRP F Sbjct: 110 ----LKNAVGRPRPDF 121 >SPAPB1A10.02 |||chromosome segregation protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 336 Score = 29.5 bits (63), Expect = 0.44 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -1 Query: 350 LGSAPTSKQMHTAATSRTIGRSMSKCHNTLCFACIS 243 LG P S+Q + +S S S C CF CIS Sbjct: 296 LGFQPLSQQTSFSGSSTQNPHSSSTCKKAFCFQCIS 331 >SPCC777.03c |||nifs homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 396 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -1 Query: 467 QRTKK-GTITVMAATSEMENVSPVCGKERAGSLHV 366 ++TK G +VM + ++ NV +C K R ++HV Sbjct: 156 EKTKAIGISSVMFHSGQLNNVKDICNKFRPENIHV 190 >SPBC19G7.16 |iws1||transcription elongation factor complex subunit Iws1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 428 Score = 26.2 bits (55), Expect = 4.1 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = -3 Query: 468 PENEKRHDNRDGCDKRDGKRVSRMRERESWIVAREAAASARQRP 337 P K+ N D ++ V R+RE+ R+A ++ Q P Sbjct: 169 PTRTKKRSNEDNLEQMADDEVLRLREQMRLAALRDAELNSEQLP 212 >SPBP4H10.15 |||aconitate hydratase|Schizosaccharomyces pombe|chr 2|||Manual Length = 905 Score = 25.4 bits (53), Expect = 7.2 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -3 Query: 417 GKRVSRMRER-ESWIVAREAAASARQRPDFQANAYCRN 307 G ++ +RE+ S +V ++ S +Q+PD A+AY N Sbjct: 776 GSALNLIREKAHSGVVNQKVIDSIKQQPDHYADAYIFN 813 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,750,344 Number of Sequences: 5004 Number of extensions: 56279 Number of successful extensions: 158 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 158 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -