BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_J08 (654 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 25 0.64 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 25 0.64 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 24 1.5 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 2.6 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 6.0 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 6.0 AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 22 6.0 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 25.0 bits (52), Expect = 0.64 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +1 Query: 139 RKLKFHEGKLLKKVXFISWKLDNNISEVKVMKKFCIQKREDYT 267 R L+ +G ++ + I W+L ++ V +M FCI K +T Sbjct: 191 RTLQISDG--IENIGSIRWELAGTLAVVWIMCYFCIWKGVKWT 231 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 25.0 bits (52), Expect = 0.64 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +1 Query: 139 RKLKFHEGKLLKKVXFISWKLDNNISEVKVMKKFCIQKREDYT 267 R L+ +G ++ + I W+L ++ V +M FCI K +T Sbjct: 244 RTLQISDG--IENIGSIRWELAGTLAVVWIMCYFCIWKGVKWT 284 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 328 PNNEFRTESSAQLLEKLYQIGLIPTR 405 P+N RT S+ LEKLY+ + R Sbjct: 19 PSNLLRTSFSSAKLEKLYRASSLQQR 44 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 23.0 bits (47), Expect = 2.6 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -2 Query: 92 FLRYIKNNNKIKNVTEQ 42 F RY++N N++++V E+ Sbjct: 9 FRRYLRNRNQLQHVLEE 25 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +1 Query: 244 IQKREDYTKYNKLSRDIRE 300 +++ E+Y Y KL R++R+ Sbjct: 392 VKQVEEYMAYRKLPREMRQ 410 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +1 Query: 244 IQKREDYTKYNKLSRDIRE 300 +++ E+Y Y KL R++R+ Sbjct: 360 VKQVEEYMAYRKLPREMRQ 378 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -1 Query: 447 ERTGRDISGQGKIPSCRYQSNLVKFF 370 E TG D + C Y+ N KFF Sbjct: 116 EYTGDDCQKTYQYVQCHYKQNPEKFF 141 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,496 Number of Sequences: 438 Number of extensions: 3669 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -