BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_J08 (654 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15750.1 68418.m01842 RNA-binding S4 domain-containing protei... 186 1e-47 At5g39850.1 68418.m04829 40S ribosomal protein S9 (RPS9C) 40S ri... 58 5e-09 At5g15200.1 68418.m01781 40S ribosomal protein S9 (RPS9B) 40S ri... 55 4e-08 At1g45545.1 68414.m05199 hypothetical protein contains Pfam prof... 31 0.88 At5g41620.1 68418.m05057 expressed protein weak similarity to mi... 30 1.5 At3g47460.1 68416.m05161 SMC2-like condensin, putative similar t... 29 2.7 At2g27920.2 68415.m03383 serine carboxypeptidase S10 family prot... 29 2.7 At2g27920.1 68415.m03384 serine carboxypeptidase S10 family prot... 29 2.7 At5g22260.1 68418.m02593 male sterility 1 protein, putative (MS1... 29 3.6 At3g01360.1 68416.m00057 expressed protein contains Pfam profile... 29 3.6 At1g79280.1 68414.m09242 expressed protein weak similarity to Nu... 29 3.6 At4g04110.1 68417.m00581 Toll-Interleukin-Resistance (TIR) domai... 28 4.7 At3g02990.1 68416.m00294 heat shock factor protein 2 (HSF2) / he... 27 8.2 At1g64180.1 68414.m07270 intracellular protein transport protein... 27 8.2 >At5g15750.1 68418.m01842 RNA-binding S4 domain-containing protein 40S RIBOSOMAL PROTEINs - different species Length = 182 Score = 186 bits (453), Expect = 1e-47 Identities = 86/173 (49%), Positives = 119/173 (68%) Frame = +1 Query: 136 VRKLKFHEGKLLKKVXFISWKLDNNISEVKVMKKFCIQKREDYTKYNKLSRDIRELANKI 315 +RKLK+HE KL+KKV F+ WK + N E ++ ++ + R+DY KY+ L R +++L N + Sbjct: 1 MRKLKYHEKKLIKKVNFLEWKREGNHRENEITYRYHMGSRDDYKKYSGLCRMVQKLTNIM 60 Query: 316 KDLDPNNEFRTESSAQLLEKLYQIGLIPTRWDLALATNVSASSFCRRRLPVLMVRNKMSX 495 K +DP + FR + + LLEKLY +G+IPTR L L +S SSFCRRRL ++V K + Sbjct: 61 KQMDPADPFRIQMTDMLLEKLYNMGVIPTRKSLTLTERLSVSSFCRRRLSTVLVHLKFAE 120 Query: 496 TIKEATKFIEQRHVXVGPEVVKDPAFLVNRSLEDFVTWVDGSAITKHVLXYNE 654 KEA +IEQ HV VGPE + DPAFLV R++EDF+TWVD S I + VL YN+ Sbjct: 121 HHKEAVTYIEQGHVRVGPETITDPAFLVTRNMEDFITWVDSSKIKRKVLEYND 173 >At5g39850.1 68418.m04829 40S ribosomal protein S9 (RPS9C) 40S ribosomal protein S9 - Chlamydomonas sp.,EMBL:AU066528 Length = 197 Score = 58.0 bits (134), Expect = 5e-09 Identities = 38/124 (30%), Positives = 68/124 (54%), Gaps = 2/124 (1%) Frame = +1 Query: 214 SEVKVMKKFCIQ-KREDYTKYNKLSRDIRELANKIKDLDPNNEFRTESSAQLLEKLYQIG 390 +E+K++ ++ ++ KRE + LSR IR A ++ LD N R LL ++ + G Sbjct: 28 AELKLVGEYGLRCKRELWRVQYTLSR-IRNAARELLTLDEKNPRRIFEGEALLRRMNRYG 86 Query: 391 LIP-TRWDLALATNVSASSFCRRRLPVLMVRNKMSXTIKEATKFIEQRHVXVGPEVVKDP 567 L+ T+ L ++ +F RRL ++ ++ M+ +I A I QRH+ VG ++V P Sbjct: 87 LLDETQNKLDYVLALTVENFLERRLQTIVFKSGMAKSIHHARVLIRQRHIRVGRQLVNIP 146 Query: 568 AFLV 579 +F+V Sbjct: 147 SFMV 150 >At5g15200.1 68418.m01781 40S ribosomal protein S9 (RPS9B) 40S ribosomal protein S9, Chlamydomonas sp., EMBL:AU066528 Length = 198 Score = 55.2 bits (127), Expect = 4e-08 Identities = 39/126 (30%), Positives = 67/126 (53%), Gaps = 4/126 (3%) Frame = +1 Query: 214 SEVKVMKKFCIQ-KREDYTKYNKLSRDIRELANKIKDLDPNNEFRTESSAQLLEKLYQIG 390 SE+K++ ++ ++ KRE + LSR IR A + LD + R LL ++ + G Sbjct: 28 SELKLVGEYGLRNKRELWRVQYSLSR-IRNAARDLLTLDEKSPRRIFEGEALLRRMNRYG 86 Query: 391 LIP---TRWDLALATNVSASSFCRRRLPVLMVRNKMSXTIKEATKFIEQRHVXVGPEVVK 561 L+ + D LA V +F RRL ++ ++ M+ +I + I QRH+ VG ++V Sbjct: 87 LLDESQNKLDYVLALTVE--NFLERRLQTIVFKSGMAKSIHHSRVLIRQRHIRVGKQLVN 144 Query: 562 DPAFLV 579 P+F+V Sbjct: 145 IPSFMV 150 >At1g45545.1 68414.m05199 hypothetical protein contains Pfam profile PF05701: Plant protein of unknown function (DUF827) Length = 752 Score = 30.7 bits (66), Expect = 0.88 Identities = 16/62 (25%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +1 Query: 205 NNISEVKVMKKFCIQKREDYTKYNKLSRDIRELAN-KIKDLDPNNEFRTESSAQLLEKLY 381 N I ++ K I E+Y + +K + ++ E AN K+ ++ E E +++LE L Sbjct: 575 NKIEDISSSPKSIIISVEEYYELSKQAHEVEEAANRKLAEIVSKIEVAKEEESRILENLE 634 Query: 382 QI 387 ++ Sbjct: 635 EV 636 >At5g41620.1 68418.m05057 expressed protein weak similarity to microtubule binding protein D-CLIP-190 (GI:2773363) [Drosophila melanogaster]; weak similarity to Synaptonemal complex protein 1 (SCP-1 protein) (Swiss-Prot:Q15431) [Homo sapiens]; weak similarity to DNA double-strand break repair rad50 ATPase. (Swiss-Prot:P58301) [Pyrococcus furiosus] Length = 543 Score = 29.9 bits (64), Expect = 1.5 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 136 VRKLKFHEGKLLKKVXFISWKLDNNISEVKVMKKFCIQKREDYTKYNKLSRDI-RELANK 312 VRK E KL K+ + K+ +SEVK C+++ E +K NK+ + E A Sbjct: 197 VRKALEDERKLRKRSESLHRKMARELSEVKSSLSNCVKELERGSKSNKMMELLCDEFAKG 256 Query: 313 IKDLD 327 IK + Sbjct: 257 IKSYE 261 >At3g47460.1 68416.m05161 SMC2-like condensin, putative similar to SMC2-like condensin (TITAN3) [Arabidopsis thaliana] GI:14279543; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1171 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +1 Query: 256 EDYTKYNKLSRDIRELANKIKDLDPNNEFRTESSAQLLEKLYQIGLIPTR 405 E TK+ + + E+ IK+L P T+ AQL K+Y + L R Sbjct: 678 EAETKFRAHQKSLSEIEANIKELQPLQTKFTDMKAQLELKMYDMSLFLKR 727 >At2g27920.2 68415.m03383 serine carboxypeptidase S10 family protein similar to retinoid-inducible serine carboxypeptidase precursor (GI:15146429) [Mus musculus] Length = 389 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/50 (28%), Positives = 28/50 (56%) Frame = +1 Query: 178 VXFISWKLDNNISEVKVMKKFCIQKREDYTKYNKLSRDIRELANKIKDLD 327 V F ++ LD + V + I+K E KY++ D+R L++ ++D++ Sbjct: 194 VDFYNFLLDTGMDPVSLTTSLKIKKEEKIKKYSRYLNDMRSLSD-VEDVE 242 >At2g27920.1 68415.m03384 serine carboxypeptidase S10 family protein similar to retinoid-inducible serine carboxypeptidase precursor (GI:15146429) [Mus musculus] Length = 461 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/50 (28%), Positives = 28/50 (56%) Frame = +1 Query: 178 VXFISWKLDNNISEVKVMKKFCIQKREDYTKYNKLSRDIRELANKIKDLD 327 V F ++ LD + V + I+K E KY++ D+R L++ ++D++ Sbjct: 266 VDFYNFLLDTGMDPVSLTTSLKIKKEEKIKKYSRYLNDMRSLSD-VEDVE 314 >At5g22260.1 68418.m02593 male sterility 1 protein, putative (MS1) identical to male sterility 1 protein [Arabidopsis thaliana] gi|15554513|emb|CAC69663 PMID:11696184; contains Pfam profile PF00628: PHD-finger; identical to cDNA male sterility 1 protein (ms1 gene) GI:15554514 Length = 672 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/65 (26%), Positives = 34/65 (52%), Gaps = 3/65 (4%) Frame = +1 Query: 139 RKLKFHEGKLLKKVXFISWKLDNNISEVKVMKKFCIQKREDYT---KYNKLSRDIRELAN 309 + L G+ L I+WK ++ +E+KV + CI ++D T Y + R R++ Sbjct: 496 KTLHLDRGEELGIFCTIAWKCHHHNNEIKVPPQECIVVKKDATLSEVYGEAERVFRDIYW 555 Query: 310 KIKDL 324 +++D+ Sbjct: 556 ELRDV 560 >At3g01360.1 68416.m00057 expressed protein contains Pfam profile PF04819: Family of unknown function (DUF716) (Plant viral-response family) Length = 319 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 253 REDYTKYNKLSRDIRELANKIKDLDPNNEFRTESS 357 R+D++KY L ++ L+ D D +E R ES+ Sbjct: 271 RQDHSKYRPLGAELENLSTFTLDSDEEDEVREESN 305 >At1g79280.1 68414.m09242 expressed protein weak similarity to Nucleoprotein TPR (Swiss-Prot:P12270) [Homo sapiens] Length = 2111 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +1 Query: 259 DYTKYNKLSRDIRELANKIKDLDPNNEFRTESSAQLLEKLYQIGLI 396 D YN+L ++R+L K+K D + E + LLEK +I L+ Sbjct: 1373 DIADYNRLKDEVRQLEEKLKAKDAHAE---DCKKVLLEKQNKISLL 1415 >At4g04110.1 68417.m00581 Toll-Interleukin-Resistance (TIR) domain-containing protein domain signature TIR exists, suggestive of a disease resistance protein. Length = 239 Score = 28.3 bits (60), Expect = 4.7 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 385 FGKVFPKV-EHLTLS*IHYLDRGLLSCLRAL*YHETIC 275 FGK+F K ++ T I+ R L+ L YH TIC Sbjct: 151 FGKIFKKTCQNRTEDEINLRRRALIDVANTLGYHSTIC 188 >At3g02990.1 68416.m00294 heat shock factor protein 2 (HSF2) / heat shock transcription factor 2 (HSTF2) identical to heat shock transcription factor 2 (HSF2) SP:Q96320 from [Arabidopsis thaliana]; contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 468 Score = 27.5 bits (58), Expect = 8.2 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +1 Query: 187 ISWKLDNNISEVKVMKKFCIQKREDYTKYNKLSRDIREL-ANKIKDLDPNN-EFRTE 351 +SW NN V + +F Q Y K+N S +R+L + +DP+ EF E Sbjct: 41 VSWSSGNNSFVVWNVPEFAKQFLPKYFKHNNFSSFVRQLNTYGFRKVDPDRWEFANE 97 >At1g64180.1 68414.m07270 intracellular protein transport protein USO1-related similar to Rap8 (GI:2326183) [Rhynchosciara americana]; contains weak similarity to Swiss-Prot:P25386 intracellular protein transport protein USO1 [Saccharomyces cerevisiae] Length = 593 Score = 27.5 bits (58), Expect = 8.2 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +1 Query: 157 EGKLLKKVXFISWKLDNNISEVKVMKKFCIQKREDYTKYNK-LSRDIRELANKIKDLD 327 E KL K+ + KL +SEVK C+++ E T+ K L R E A IK + Sbjct: 272 ERKLRKRSESLYRKLAQELSEVKSTLSNCVKEMERGTESKKILERLCDEFAKGIKSYE 329 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,411,367 Number of Sequences: 28952 Number of extensions: 260544 Number of successful extensions: 639 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 639 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -