BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_J06 (645 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY183376-1|AAO24766.1| 128|Anopheles gambiae cytochrome b5 prot... 72 1e-14 >AY183376-1|AAO24766.1| 128|Anopheles gambiae cytochrome b5 protein. Length = 128 Score = 72.1 bits (169), Expect = 1e-14 Identities = 32/58 (55%), Positives = 41/58 (70%) Frame = +3 Query: 87 EVADSKTATETLFIIDNIVYDVHKFLDEHPGGHEVLINVAGKDASEEFEDVGHSMDAR 260 +V T T +I N +YDV +FL+EHPGG EVL+ AG++A+E FEDVGHS DAR Sbjct: 11 DVKSHNTNKSTWIVIHNDIYDVTEFLNEHPGGEEVLLEQAGREATEAFEDVGHSSDAR 68 Score = 27.9 bits (59), Expect = 0.29 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +1 Query: 265 LMKGYVVGELVDADK--VPISKKQYSWEDTAKTSETEASFVNSWKFPVXXXXXXXXXYSY 438 +MK + VGEL++A++ +P+ KK+ W K + + + + W P+ Y + Sbjct: 70 MMKKFKVGELIEAERKQIPV-KKEPDW----KMDQQDDNQLKQWIVPLILGLLATILYRF 124 Query: 439 IF 444 F Sbjct: 125 YF 126 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 532,928 Number of Sequences: 2352 Number of extensions: 8730 Number of successful extensions: 23 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63559560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -