BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_I22 (647 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 25 1.6 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 25 1.6 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 25 2.7 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 24 4.8 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 23 8.3 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 25.4 bits (53), Expect = 1.6 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 313 QLTVQNRQAQIAVVPSAAALIIRALKEP 396 QL + RQ ++AV PS+ L A K P Sbjct: 1610 QLLERTRQKRMAVCPSSVVLAREAFKHP 1637 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 25.4 bits (53), Expect = 1.6 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -1 Query: 299 RPFQSLVAL--AMSSPTFLGDRPRGPILGAKDDVAPTSPPTHRKFTILISFG 150 RPF S+ L +S+P LG RP+G LG P+ P H + + G Sbjct: 548 RPFFSIPGLPPGLSAPLGLGMRPQGGPLG-----LPSHHPLHPSLGLSMGLG 594 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 24.6 bits (51), Expect = 2.7 Identities = 19/73 (26%), Positives = 31/73 (42%) Frame = +1 Query: 196 VGATSSLAPKIGPLGLSPKKVGDDIAKATSDWKGLKITVQLTVQNRQAQIAVVPSAAALI 375 V T++ A P+ + +D A D + L + ++ RQ AVV I Sbjct: 2 VSQTAAAAAPADPIVDVEMESAEDAEAAKKDAELLAVQ-EIRDHARQIDKAVVSKEPRFI 60 Query: 376 IRALKEPPRDRKK 414 +R L+ P R+K Sbjct: 61 LRVLRSLPTTRRK 73 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.8 bits (49), Expect = 4.8 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 524 SFTEPERYRAIDLFXMIFAMPITSSREMLP 435 +F PER AIDL + ++ T+ E+LP Sbjct: 165 TFVTPERKSAIDLTFVSQSLMETTGWEVLP 194 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 23.0 bits (47), Expect = 8.3 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 241 LSPKKVGDDIAKATSDW 291 L PKK+ D AK DW Sbjct: 200 LPPKKIKDPEAKKPEDW 216 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 702,061 Number of Sequences: 2352 Number of extensions: 14257 Number of successful extensions: 33 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -