BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_I16 (654 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23962| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 28 7.6 SB_39817| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_23962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +1 Query: 280 LLHRVFVAEPLENLKQSALKSGVSEDDFQAFLVYAGGLFANSGNYKGFGD 429 +L+ F P E S L+ G+ E + AF+ + + N G G+GD Sbjct: 35 ILNEDFEVNP-EEFPGSFLRGGILEGSWFAFVSFTTVGYVNEGGLDGYGD 83 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -2 Query: 626 VQLLEKYVVTPLLAKPRLVNLGASP*MAFLVF 531 + L + V TPLL R VNLG P L+F Sbjct: 93 IDKLREVVETPLLHPERFVNLGIEPPKGVLLF 124 >SB_39817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 503 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/57 (28%), Positives = 32/57 (56%) Frame = +1 Query: 55 LIKYCTQRT*KIIMEDKSNFLLPNNQRFVELDSSQAFDNLTTNXKLYAHYLSQAAWN 225 L+ Y +R + + ++F L Q F++ Q +D ++T + YA+YL++ AW+ Sbjct: 76 LMSYGNERFIQYMASRTTSFTL---QGFLDKSGVQGYD-MSTFVRRYANYLNEKAWS 128 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,898,023 Number of Sequences: 59808 Number of extensions: 381114 Number of successful extensions: 880 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 880 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -