BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_I12 (302 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U15009-1|AAA57034.1| 126|Homo sapiens Sm D3 protein. 51 8e-07 CR456583-1|CAG30469.1| 126|Homo sapiens SNRPD3 protein. 51 8e-07 BC003150-1|AAH03150.1| 126|Homo sapiens small nuclear ribonucle... 51 8e-07 BC000457-1|AAH00457.1| 126|Homo sapiens small nuclear ribonucle... 51 8e-07 >U15009-1|AAA57034.1| 126|Homo sapiens Sm D3 protein. Length = 126 Score = 50.8 bits (116), Expect = 8e-07 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = +1 Query: 154 VPIKVLHEAEGHGXDLLKQIPVXFIQGKLIEAEDNMNCQMT 276 VPIKVLHEAEGH + +GKLIEAEDNMNCQM+ Sbjct: 5 VPIKVLHEAEGHIVTCETNTGEVY-RGKLIEAEDNMNCQMS 44 >CR456583-1|CAG30469.1| 126|Homo sapiens SNRPD3 protein. Length = 126 Score = 50.8 bits (116), Expect = 8e-07 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = +1 Query: 154 VPIKVLHEAEGHGXDLLKQIPVXFIQGKLIEAEDNMNCQMT 276 VPIKVLHEAEGH + +GKLIEAEDNMNCQM+ Sbjct: 5 VPIKVLHEAEGHIVTCETNTGEVY-RGKLIEAEDNMNCQMS 44 >BC003150-1|AAH03150.1| 126|Homo sapiens small nuclear ribonucleoprotein D3 polypeptide 18kDa protein. Length = 126 Score = 50.8 bits (116), Expect = 8e-07 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = +1 Query: 154 VPIKVLHEAEGHGXDLLKQIPVXFIQGKLIEAEDNMNCQMT 276 VPIKVLHEAEGH + +GKLIEAEDNMNCQM+ Sbjct: 5 VPIKVLHEAEGHIVTCETNTGEVY-RGKLIEAEDNMNCQMS 44 >BC000457-1|AAH00457.1| 126|Homo sapiens small nuclear ribonucleoprotein D3 polypeptide 18kDa protein. Length = 126 Score = 50.8 bits (116), Expect = 8e-07 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = +1 Query: 154 VPIKVLHEAEGHGXDLLKQIPVXFIQGKLIEAEDNMNCQMT 276 VPIKVLHEAEGH + +GKLIEAEDNMNCQM+ Sbjct: 5 VPIKVLHEAEGHIVTCETNTGEVY-RGKLIEAEDNMNCQMS 44 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,335,401 Number of Sequences: 237096 Number of extensions: 523719 Number of successful extensions: 506 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 496 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 76,859,062 effective HSP length: 77 effective length of database: 58,602,670 effective search space used: 1347861410 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -