BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_I08 (654 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 23 2.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.8 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 22 3.8 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 21 6.7 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 6.7 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 23.0 bits (47), Expect = 2.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 183 ILTSETKVIVQGFHWKAGLPSTANKPLTMVLKLLEE 290 I S ++I W +P+ PL+ L LLEE Sbjct: 199 ICESAAQLIFMNVQWVRSIPAFTCLPLSDQLLLLEE 234 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 3.8 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = -3 Query: 631 YNSDATTFVHCSW 593 Y D T ++HC W Sbjct: 1287 YPGDCTRYLHCLW 1299 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 22.2 bits (45), Expect = 3.8 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 183 ILTSETKVIVQGFHWKAGLPSTANKPLTMVLKLLEE 290 I S +++ W +P+ PL+ L LLEE Sbjct: 199 ICESAAQLLFMNVQWVRSIPAFTCLPLSDQLLLLEE 234 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/32 (25%), Positives = 16/32 (50%) Frame = +3 Query: 42 FPFRRFTFNNSTMAMPVRVLSKFKDGLKLGNV 137 FP+R + + PV ++ K DG+ + + Sbjct: 216 FPYRGVMIDTARNFFPVDLIRKVVDGMAMAKL 247 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 6.7 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -1 Query: 336 NTGLPRCSVPAFFGD 292 NT + +C++P+F D Sbjct: 138 NTAVLKCNIPSFVAD 152 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,167 Number of Sequences: 336 Number of extensions: 3041 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -